Human GH1/GH/GH-N ORF/cDNA clone-Lentivirus particle (NM_022559)

Cat. No.: vGMLP004749

Pre-made Human GH1/GH/GH-N Lentiviral expression plasmid for GH1 lentivirus packaging, GH1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to GH1/HGH/GH1/GH products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004749 Human GH1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004749
Gene Name GH1
Accession Number NM_022559
Gene ID 2688
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 609 bp
Gene Alias GH,GH-N,GHB5,GHN,hGH-N,IGHD1B
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTACAGGCTCCCGGACGTCCCTGCTCCTGGCTTTTGGCCTGCTCTGCCTGCCCTGGCTTCAAGAGGGCAGTGCCTTCCCAACCATTCCCTTATCCAGGCTTTTTGACAACGCTATGCTCCGCGCCCATCGTCTGCACCAGCTGGCCTTTGACACCTACCAGGAGTTTAACCCCCAGACCTCCCTCTGTTTCTCAGAGTCTATTCCGACACCCTCCAACAGGGAGGAAACACAACAGAAATCCAACCTAGAGCTGCTCCGCATCTCCCTGCTGCTCATCCAGTCGTGGCTGGAGCCCGTGCAGTTCCTCAGGAGTGTCTTCGCCAACAGCCTGGTGTACGGCGCCTCTGACAGCAACGTCTATGACCTCCTAAAGGACCTAGAGGAAGGCATCCAAACGCTGATGGGGAGGCTGGAAGATGGCAGCCCCCGGACTGGGCAGATCTTCAAGCAGACCTACAGCAAGTTCGACACAAACTCACACAACGATGACGCACTACTCAAGAACTACGGGCTGCTCTACTGCTTCAGGAAGGACATGGACAAGGTCGAGACATTCCTGCGCATCGTGCAGTGCCGCTCTGTGGAGGGCAGCTGTGGCTTCTAG
ORF Protein Sequence MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T19784-Ab Anti-SOMA/ GH1/ GH functional antibody
    Target Antigen GM-Tg-g-T19784-Ag GH1 protein
    ORF Viral Vector pGMLP004749 Human GH1 Lentivirus plasmid
    ORF Viral Vector pGMLV000702 Human GH1 Lentivirus plasmid
    ORF Viral Vector vGMLP004749 Human GH1 Lentivirus particle
    ORF Viral Vector vGMLV000702 Human GH1 Lentivirus particle


    Target information

    Target ID GM-T19784
    Target Name GH1/HGH
    Gene Group Identifier
    (Target Gene ID in Homo species)
    2688
    Gene ID 14599 (Mus musculus), 24391 (Rattus norvegicus), 2688 (Homo sapiens), 493931 (Felis catus)
    718156 (Macaca mulatta)
    Gene Symbols & Synonyms Gh,Gh1,GH1,Ghb1,RNGHGP,GH,GHN,GH-N,GHB5,IGHD2,hGH-N,IGHD1A,IGHD1B,GHB3
    Target Alternative Names GH,GH-N,GH-N),GH1,GHB3,GHB5,GHN,Gh,Gh1,Ghb1,Growth hormone (GH,Growth hormone 1,HGH,IGHD1A,IGHD1B,IGHD2,Pituitary growth hormone,RNGHGP,Somatotropin,hGH-N
    Uniprot Accession P01241,P01244,P06880,P33093,P46404
    Additional SwissProt Accessions: P06880,P01244,P01241,P46404,P33093
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Ovary Cancer
    Disease from KEGG Cytokine-cytokine receptor interaction, Neuroactive ligand-receptor interaction, PI3K-Akt signaling pathway, JAK-STAT signaling pathway, Growth hormone synthesis, secretion and action
    Gene Ensembl ENSMUSG00000020713, ENSG00000259384, ENSMMUG00000039847
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.