Human Angptl8/C19orf80/PRO1185 ORF/cDNA clone-Lentivirus particle (NM_018687)

Cat. No.: vGMLP004671

Pre-made Human Angptl8/C19orf80/PRO1185 Lentiviral expression plasmid for Angptl8 lentivirus packaging, Angptl8 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to ANGPTL8/Betatrophin/Angptl8/C19orf80 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004671 Human Angptl8 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004671
Gene Name Angptl8
Accession Number NM_018687
Gene ID 55908
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 597 bp
Gene Alias C19orf80,PRO1185,PVPA599,RIFL,TD26
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCAGTGCCTGCTCTGTGCCTGCTCTGGGCCCTGGCAATGGTGACCCGGCCTGCCTCAGCGGCCCCCATGGGCGGCCCAGAACTGGCACAGCATGAGGAGCTGACCCTGCTCTTCCATGGGACCCTGCAGCTGGGCCAGGCCCTCAACGGTGTGTACAGGACCACGGAGGGACGGCTGACAAAGGCCAGGAACAGCCTGGGTCTCTATGGCCGCACAATAGAACTCCTGGGGCAGGAGGTCAGCCGGGGCCGGGATGCAGCCCAGGAACTTCGGGCAAGCCTGTTGGAGACTCAGATGGAGGAGGATATTCTGCAGCTGCAGGCAGAGGCCACAGCTGAGGTGCTGGGGGAGGTGGCCCAGGCACAGAAGGTGCTACGGGACAGCGTGCAGCGGCTAGAAGTCCAGCTGAGGAGCGCCTGGCTGGGCCCTGCCTACCGAGAATTTGAGGTCTTAAAGGCTCACGCTGACAAGCAGAGCCACATCCTATGGGCCCTCACAGGCCACGTGCAGCGGCAGAGGCGGGAGATGGTGGCACAGCAGCATCGGCTGCGACAGATCCAGGAGAGACTCCACACAGCGGCGCTCCCAGCCTGA
ORF Protein Sequence MPVPALCLLWALAMVTRPASAAPMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0614-Ab Anti-ANGL8/ ANGPTL8/ C19orf80 functional antibody
    Target Antigen GM-Tg-g-SE0614-Ag ANGPTL8 protein
    ORF Viral Vector pGMLP004671 Human Angptl8 Lentivirus plasmid
    ORF Viral Vector vGMLP004671 Human Angptl8 Lentivirus particle


    Target information

    Target ID GM-SE0614
    Target Name ANGPTL8/Betatrophin
    Gene Group Identifier
    （Target Gene ID in Homo species)         		55908
    Gene ID 100361444 (Rattus norvegicus), 101902412 (Bos taurus), 102155149 (Canis lupus familiaris), 102902262 (Felis catus)
    106994638 (Macaca mulatta), 111774288 (Equus caballus), 55908 (Homo sapiens), 624219 (Mus musculus)
    Gene Symbols & Synonyms Angptl8,ANGPTL8,C7H19orf80,RIFL,TD26,PRO1185,PVPA599,C19orf80,Rifl,Gm6484,EG624219
    Target Alternative Names ANGPTL8,Angiopoietin-like protein 8,Angptl8,Betatrophin,C19orf80,C7H19orf80,EG624219,Gm6484,Lipasin,PRO1185,PVPA599,RIFL,Refeeding-induced fat and liver protein,Rifl,TD26
    Uniprot Accession Q6UXH0,Q8R1L8
    Additional SwissProt Accessions: Q6UXH0,Q8R1L8
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG Cholesterol metabolism
    Gene Ensembl ENSBTAG00000009570, ENSCAFG00845021478, ENSMMUG00000009337, ENSECAG00000015577, ENSG00000130173, ENSMUSG00000047822
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.