Human GP1BB/BDPLT1/BS ORF/cDNA clone-Lentivirus particle (NM_000407)

Cat. No.: vGMLP004607

Pre-made Human GP1BB/BDPLT1/BS Lentiviral expression plasmid for GP1BB lentivirus packaging, GP1BB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CD42c/GP1BB/GP1BB/BDPLT1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004607 Human GP1BB Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004607
Gene Name GP1BB
Accession Number NM_000407
Gene ID 2812
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 621 bp
Gene Alias BDPLT1,BS,CD42C,GPIBB,GPIbbeta
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCTCCGGGCCGCGCGGGGCGCTGAGCTTACTGCTCCTGCTGCTGGCCCCGCCGAGCCGCCCGGCCGCAGGTTGCCCGGCGCCCTGTAGCTGCGCGGGGACGCTCGTGGACTGCGGGCGCCGCGGGCTGACTTGGGCCTCGCTGCCGACCGCCTTCCCTGTCGACACAACCGAGCTGGTGCTGACCGGCAACAACCTGACGGCGCTGCCGCCGGGGCTGCTGGACGCGCTGCCCGCGCTGCGCACCGCACACCTGGGCGCCAACCCCTGGCGCTGCGACTGCCGCCTTGTGCCGCTGCGCGCCTGGCTGGCCGGCCGCCCCGAGCGTGCGCCCTACCGCGACCTGCGTTGCGTGGCGCCCCCAGCGCTGCGCGGCCGCCTGCTGCCCTATCTGGCCGAGGACGAGCTGCGCGCCGCTTGCGCTCCCGGCCCGCTCTGCTGGGGGGCGCTGGCGGCGCAGCTTGCGCTGCTGGGCCTTGGGCTGCTGCACGCGTTGCTGCTGGTGCTGCTGCTGTGCCGCCTGCGGAGGCTGCGGGCCCGGGCCCGCGCTCGCGCCGCAGCCCGGCTGTCGCTGACCGACCCGCTGGTGGCCGAGCGAGCCGGAACCGACGAGTCCTGA
ORF Protein Sequence MGSGPRGALSLLLLLLAPPSRPAAGCPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0486-Ab Anti-GP1BB/ BDPLT1/ BS monoclonal antibody
    Target Antigen GM-Tg-g-MP0486-Ag GP1BB VLP (virus-like particle)
    ORF Viral Vector pGMLP004607 Human GP1BB Lentivirus plasmid
    ORF Viral Vector vGMLP004607 Human GP1BB Lentivirus particle


    Target information

    Target ID GM-MP0486
    Target Name CD42c/GP1BB
    Gene Group Identifier
    （Target Gene ID in Homo species)         		2812
    Gene ID 111774801 (Equus caballus), 116727 (Rattus norvegicus), 14724 (Mus musculus), 2812 (Homo sapiens)
    712129 (Macaca mulatta)
    Gene Symbols & Synonyms GP1BB,Gp1bb,BS,CD42C,GPIBB,BDPLT1,GPIbbeta
    Target Alternative Names Antigen CD42b-beta,BDPLT1,BS,CD42C,CD42c,GP-Ib beta,GP1BB,GPIBB,GPIb-beta,GPIbB,GPIbbeta,Gp1bb,Platelet glycoprotein Ib beta chain
    Uniprot Accession P13224,P56400,Q9JJM7
    Additional SwissProt Accessions: Q9JJM7,P56400,P13224
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG ECM-receptor interaction, Platelet activation, Hematopoietic cell lineage
    Gene Ensembl ENSMUSG00000050761, ENSG00000203618
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.