Human FGF19 ORF/cDNA clone-Lentivirus particle (NM_005117)
Cat. No.: vGMLP004563
Pre-made Human FGF19/ Lentiviral expression plasmid for FGF19 lentivirus packaging, FGF19 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
FGF19 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP004563 | Human FGF19 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP004563 |
| Gene Name | FGF19 |
| Accession Number | NM_005117 |
| Gene ID | 9965 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 651 bp |
| Gene Alias | |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCGGAGCGGGTGTGTGGTGGTCCACGTATGGATCCTGGCCGGCCTCTGGCTGGCCGTGGCCGGGCGCCCCCTCGCCTTCTCGGACGCGGGGCCCCACGTGCACTACGGCTGGGGCGACCCCATCCGCCTGCGGCACCTGTACACCTCCGGCCCCCACGGGCTCTCCAGCTGCTTCCTGCGCATCCGTGCCGACGGCGTCGTGGACTGCGCGCGGGGCCAGAGCGCGCACAGTTTGCTGGAGATCAAGGCAGTCGCTCTGCGGACCGTGGCCATCAAGGGCGTGCACAGCGTGCGGTACCTCTGCATGGGCGCCGACGGCAAGATGCAGGGGCTGCTTCAGTACTCGGAGGAAGACTGTGCTTTCGAGGAGGAGATCCGCCCAGATGGCTACAATGTGTACCGATCCGAGAAGCACCGCCTCCCGGTCTCCCTGAGCAGTGCCAAACAGCGGCAGCTGTACAAGAACAGAGGCTTTCTTCCACTCTCTCATTTCCTGCCCATGCTGCCCATGGTCCCAGAGGAGCCTGAGGACCTCAGGGGCCACTTGGAATCTGACATGTTCTCTTCGCCCCTGGAGACCGACAGCATGGACCCATTTGGGCTTGTCACCGGACTGGAGGCCGTGAGGAGTCCCAGCTTTGAGAAGTAA |
| ORF Protein Sequence | MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE0215-Ab | Anti-FGF19 functional antibody |
| Target Antigen | GM-Tg-g-SE0215-Ag | FGF19 protein |
| Cytokine | cks-Tg-g-GM-SE0215 | fibroblast growth factor 19 (FGF19) protein & antibody |
| ORF Viral Vector | pGMLP004563 | Human FGF19 Lentivirus plasmid |
| ORF Viral Vector | pGMAAV000215 | Human FGF19 Adeno-associate virus(AAV) plasmid |
| ORF Viral Vector | vGMLP004563 | Human FGF19 Lentivirus particle |
| ORF Viral Vector | vGMAAV000215 | Human FGF19 Adeno-associate virus(AAV) particle |
Target information
| Target ID | GM-SE0215 |
| Target Name | FGF19 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
9965 |
| Gene ID |
100060488 (Equus caballus), 101087099 (Felis catus), 14170 (Mus musculus), 170582 (Rattus norvegicus) 483681 (Canis lupus familiaris), 521475 (Bos taurus), 709109 (Macaca mulatta), 9965 (Homo sapiens) |
| Gene Symbols & Synonyms | FGF19,Fgf15,Fgf19,Fgf8a,FGF8A |
| Target Alternative Names | FGF-19,FGF19,FGF8A,Fgf15,Fgf19,Fgf8a,Fibroblast growth factor 19 |
| Uniprot Accession |
O35622,O95750
Additional SwissProt Accessions: O35622,O95750 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Cytokine Target |
| Disease | cancer |
| Disease from KEGG | MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, PI3K-Akt signaling pathway, Regulation of actin cytoskeleton, Pathways in cancer, Melanoma, Breast cancer, Gastric cancer |
| Gene Ensembl | ENSECAG00000036646, ENSMUSG00000031073, ENSCAFG00845015136, ENSBTAG00000017285, ENSMMUG00000053386, ENSG00000162344 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


