Human APLN/APEL/XNPEP2 ORF/cDNA clone-Lentivirus particle (NM_017413)

Cat. No.: vGMLP004562

Pre-made Human APLN/APEL/XNPEP2 Lentiviral expression plasmid for APLN lentivirus packaging, APLN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to Apelin/APLN/APLN/APEL products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004562 Human APLN Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004562
Gene Name APLN
Accession Number NM_017413
Gene ID 8862
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 234 bp
Gene Alias APEL,XNPEP2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAATCTGCGGCTCTGCGTGCAGGCGCTCCTGCTGCTCTGGCTCTCCTTGACCGCGGTGTGTGGAGGGTCCCTGATGCCGCTTCCCGATGGGAATGGGCTGGAAGACGGCAATGTCCGCCACCTGGTGCAGCCCAGAGGGTCAAGGAATGGGCCAGGGCCCTGGCAGGGAGGTCGGAGGAAATTCCGCCGCCAGCGGCCCCGCCTCTCCCATAAGGGACCCATGCCTTTCTGA
ORF Protein Sequence MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T58674-Ab Anti-APEL/ Apelin/ APLN functional antibody
    Target Antigen GM-Tg-g-T58674-Ag Apelin/APLN protein
    Cytokine cks-Tg-g-GM-T58674 apelin (APLN) protein & antibody
    ORF Viral Vector pGMLP004562 Human APLN Lentivirus plasmid
    ORF Viral Vector vGMLP004562 Human APLN Lentivirus particle


    Target information

    Target ID GM-T58674
    Target Name Apelin/APLN
    Gene Group Identifier
    （Target Gene ID in Homo species)         		8862
    Gene ID 101101295 (Felis catus), 102149746 (Equus caballus), 282143 (Bos taurus), 30878 (Mus musculus)
    58812 (Rattus norvegicus), 611497 (Canis lupus familiaris), 702695 (Macaca mulatta), 8862 (Homo sapiens)
    Gene Symbols & Synonyms APLN,Apln,Apel,6030430G11Rik,APEL,XNPEP2
    Target Alternative Names Apelin, APLN,Apelin,APJ endogenous ligand,APEL,XNPEP2
    Uniprot Accession Q9R0R3,Q9R0R4,Q9TUI9,Q9ULZ1
    Additional SwissProt Accessions: Q9TUI9,Q9R0R4,Q9R0R3,Q9ULZ1
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease
    Disease from KEGG Neuroactive ligand-receptor interaction
    Gene Ensembl ENSECAG00000036591, ENSBTAG00000019993, ENSMUSG00000037010, ENSG00000171388
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.