Human ELANE/ELA2/GE ORF/cDNA clone-Lentivirus particle (NM_001972)

Cat. No.: vGMLP004544

Pre-made Human ELANE/ELA2/GE Lentiviral expression plasmid for ELANE lentivirus packaging, ELANE lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to ELA2/ELANE/NE/ELANE/ELA2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004544 Human ELANE Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004544
Gene Name ELANE
Accession Number NM_001972
Gene ID 1991
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 804 bp
Gene Alias ELA2,GE,HLE,HNE,NE,PMN-E,SCN1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACCCTCGGCCGCCGACTCGCGTGTCTTTTCCTCGCCTGTGTCCTGCCGGCCTTGCTGCTGGGGGGCACCGCGCTGGCCTCGGAGATTGTGGGGGGCCGGCGAGCGCGGCCCCACGCGTGGCCCTTCATGGTGTCCCTGCAGCTGCGCGGAGGCCACTTCTGCGGCGCCACCCTGATTGCGCCCAACTTCGTCATGTCGGCCGCGCACTGCGTGGCGAATGTAAACGTCCGCGCGGTGCGGGTGGTCCTGGGAGCCCATAACCTCTCGCGGCGGGAGCCCACCCGGCAGGTGTTCGCCGTGCAGCGCATCTTCGAAAACGGCTACGACCCCGTAAACTTGCTCAACGACATCGTGATTCTCCAGCTCAACGGGTCGGCCACCATCAACGCCAACGTGCAGGTGGCCCAGCTGCCGGCTCAGGGACGCCGCCTGGGCAACGGGGTGCAGTGCCTGGCCATGGGCTGGGGCCTTCTGGGCAGGAACCGTGGGATCGCCAGCGTCCTGCAGGAGCTCAACGTGACGGTGGTGACGTCCCTCTGCCGTCGCAGCAACGTCTGCACTCTCGTGAGGGGCCGGCAGGCCGGCGTCTGTTTCGGGGACTCCGGCAGCCCCTTGGTCTGCAACGGGCTAATCCACGGAATTGCCTCCTTCGTCCGGGGAGGCTGCGCCTCAGGGCTCTACCCCGATGCCTTTGCCCCGGTGGCACAGTTTGTAAACTGGATCGACTCTATCATCCAACGCTCCGAGGACAACCCCTGTCCCCACCCCCGGGACCCGGACCCGGCCAGCAGGACCCACTGA
ORF Protein Sequence MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T40332-Ab Anti-ELNE/ NE/ ELANE functional antibody
    Target Antigen GM-Tg-g-T40332-Ag NE/ELANE protein
    ORF Viral Vector pGMLP004544 Human ELANE Lentivirus plasmid
    ORF Viral Vector vGMLP004544 Human ELANE Lentivirus particle


    Target information

    Target ID GM-T40332
    Target Name ELA2/ELANE/NE
    Gene Group Identifier
    (Target Gene ID in Homo species)
    1991
    Gene ID 100126050 (Bos taurus), 100301482 (Felis catus), 106992354 (Macaca mulatta), 111774155 (Equus caballus)
    1991 (Homo sapiens), 299606 (Rattus norvegicus), 442980 (Canis lupus familiaris), 50701 (Mus musculus)
    Gene Symbols & Synonyms ELANE,Elane,ELA2,GE,NE,HLE,HNE,SCN1,PMN-E,Ela2,F430011M15Rik
    Target Alternative Names Bone marrow serine protease,ELA2,ELANE,Ela2,Elane,Elastase-2,F430011M15Rik,GE,HLE,HNE,Human leukocyte elastase (HLE),Medullasin,NE,Neutrophil elastase,PMN elastase,PMN-E,SCN1
    Uniprot Accession P08246,Q3UP87
    Additional SwissProt Accessions: P08246,Q3UP87
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Interstitial cystitis (chronic)
    Disease from KEGG
    Gene Ensembl ENSBTAG00000046188, ENSMMUG00000009674, ENSG00000197561, ENSCAFG00845014549, ENSMUSG00000020125
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.