Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human IFNA2/IFN-alphaA/IFNA ORF/cDNA clone-Lentivirus particle (NM_000605)
Cat. No.: vGMLP004490
Pre-made Human IFNA2/IFN-alphaA/IFNA Lentiviral expression plasmid for IFNA2 lentivirus packaging, IFNA2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
IFN alpha 2A/IFNA2/IFNA2/IFN-alphaA products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP004490 | Human IFNA2 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP004490 |
| Gene Name | IFNA2 |
| Accession Number | NM_000605 |
| Gene ID | 3440 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 567 bp |
| Gene Alias | IFN-alphaA,IFNA,IFNA2B,INFA2 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCCTTGACCTTTGCTTTACTGGTGGCCCTCCTGGTGCTCAGCTGCAAGTCAAGCTGCTCTGTGGGCTGTGATCTGCCTCAAACCCACAGCCTGGGTAGCAGGAGGACCTTGATGCTCCTGGCACAGATGAGGAGAATCTCTCTTTTCTCCTGCTTGAAGGACAGACATGACTTTGGATTTCCCCAGGAGGAGTTTGGCAACCAGTTCCAAAAGGCTGAAACCATCCCTGTCCTCCATGAGATGATCCAGCAGATCTTCAATCTCTTCAGCACAAAGGACTCATCTGCTGCTTGGGATGAGACCCTCCTAGACAAATTCTACACTGAACTCTACCAGCAGCTGAATGACCTGGAAGCCTGTGTGATACAGGGGGTGGGGGTGACAGAGACTCCCCTGATGAAGGAGGACTCCATTCTGGCTGTGAGGAAATACTTCCAAAGAATCACTCTCTATCTGAAAGAGAAGAAATACAGCCCTTGTGCCTGGGAGGTTGTCAGAGCAGAAATCATGAGATCTTTTTCTTTGTCAACAAACTTGCAAGAAAGTTTAAGAAGTAAGGAATGA |
| ORF Protein Sequence | MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T63934-Ab | Anti-IFNA2/ IFN-alphaA/ IFNAB functional antibody |
| Target Antigen | GM-Tg-g-T63934-Ag | IFNA2 protein |
| Cytokine | cks-Tg-g-GM-T63934 | IFNA2 interferon, alpha 2 (IFNA2) protein & antibody |
| ORF Viral Vector | pGMLP004490 | Human IFNA2 Lentivirus plasmid |
| ORF Viral Vector | vGMLP004490 | Human IFNA2 Lentivirus particle |
Target information
| Target ID | GM-T63934 |
| Target Name | IFN alpha 2A/IFNA2 |
|
Gene Group Identifier （Target Gene ID in Homo species) |
3440 |
| Gene ID | 3440 (Homo sapiens) |
| Gene Symbols & Synonyms | IFNA2,IFNA,IFNA2B,leIF A,IFN-alphaA,IFN-alpha-2 |
| Target Alternative Names | IFN alpha 2A,IFN-alpha-2,IFN-alphaA,IFNA,IFNA2,IFNA2B,Interferon alpha-2,Interferon alpha-A (LeIF A),leIF A |
| Uniprot Accession |
P01563
Additional SwissProt Accessions: P01563 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Cytokine Target |
| Disease | cancer |
| Disease from KEGG | Cytokine-cytokine receptor interaction, PI3K-Akt signaling pathway, Toll-like receptor signaling pathway, NOD-like receptor signaling pathway, RIG-I-like receptor signaling pathway, JAK-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Alcoholic liver disease, Tuberculosis, Hepatitis C, Hepatitis B, Measles, Human cytomegalovirus infection, Influenza A, Human papillomavirus infection, Kaposi sarcoma-associated herpesvirus infection, Epstein-Barr virus infection, Pathways in cancer, Autoimmune thyroid disease, Lipid and atherosclerosis |
| Gene Ensembl | ENSG00000188379 |
| Target Classification | Tumor-associated antigen (TAA) |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.