Human CD8A/CD8/Leu2 ORF/cDNA clone-Lentivirus particle (NM_001768)

Cat. No.: vGMLP004474

Pre-made Human CD8A/CD8/Leu2 Lentiviral expression plasmid for CD8A lentivirus packaging, CD8A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CD8/CD8A/CD8a/CD8A/CD8 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004474 Human CD8A Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004474
Gene Name CD8A
Accession Number NM_001768
Gene ID 925
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 708 bp
Gene Alias CD8,Leu2,MAL,p32
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCTTACCAGTGACCGCCTTGCTCCTGCCGCTGGCCTTGCTGCTCCACGCCGCCAGGCCGAGCCAGTTCCGGGTGTCGCCGCTGGATCGGACCTGGAACCTGGGCGAGACAGTGGAGCTGAAGTGCCAGGTGCTGCTGTCCAACCCGACGTCGGGCTGCTCGTGGCTCTTCCAGCCGCGCGGCGCCGCCGCCAGTCCCACCTTCCTCCTATACCTCTCCCAAAACAAGCCCAAGGCGGCCGAGGGGCTGGACACCCAGCGGTTCTCGGGCAAGAGGTTGGGGGACACCTTCGTCCTCACCCTGAGCGACTTCCGCCGAGAGAACGAGGGCTACTATTTCTGCTCGGCCCTGAGCAACTCCATCATGTACTTCAGCCACTTCGTGCCGGTCTTCCTGCCAGCGAAGCCCACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCCCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGCGCAGTGCACACGAGGGGGCTGGACTTCGCCTGTGATATCTACATCTGGGCGCCCTTGGCCGGGACTTGTGGGGTCCTTCTCCTGTCACTGGTTATCACCCTTTACTGCAACCACAGGAACCGAAGACGTGTTTGCAAATGTCCCCGGCCTGTGGTCAAATCGGGAGACAAGCCCAGCCTTTCGGCGAGATACGTCTAA
ORF Protein Sequence MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA040-Ab Anti-CD8A/ CD8/ Leu2 monoclonal antibody
    Target Antigen GM-Tg-g-TA040-Ag CD8A VLP (virus-like particle)
    ORF Viral Vector pGMLP004474 Human CD8A Lentivirus plasmid
    ORF Viral Vector vGMLP004474 Human CD8A Lentivirus particle


    Target information

    Target ID GM-TA040
    Target Name CD8/CD8A/CD8a
    Gene Group Identifier
    (Target Gene ID in Homo species)
    925
    Gene ID 100066774 (Equus caballus), 12525 (Mus musculus), 24930 (Rattus norvegicus), 281060 (Bos taurus)
    403157 (Canis lupus familiaris), 493799 (Felis catus), 698329 (Macaca mulatta), 925 (Homo sapiens)
    Gene Symbols & Synonyms CD8A,Cd8a,Ly-2,Ly-B,Ly-35,Lyt-2,CD8,p32,Leu2,IMD116,CD8alpha
    Target Alternative Names CD8,CD8A,CD8a,CD8alpha,Cd8a,IMD116,Leu2,Ly-2,Ly-35,Ly-B,Lyt-2,T-cell surface glycoprotein CD8 alpha chain,T-lymphocyte differentiation antigen T8/Leu-2,p32
    Uniprot Accession P01731,P01732,P07725,P31783,P33706,P41688
    Additional SwissProt Accessions: P01731,P07725,P31783,P33706,P41688,P01732
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease
    Disease from KEGG Cell adhesion molecules, Antigen processing and presentation, Hematopoietic cell lineage, T cell receptor signaling pathway, Yersinia infection
    Gene Ensembl ENSECAG00000013261, ENSMUSG00000053977, ENSBTAG00000021141, ENSCAFG00845013158, ENSMMUG00000003524, ENSG00000153563
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.