Human FCER1G/FCRG ORF/cDNA clone-Lentivirus particle (NM_004106)
Cat. No.: vGMLP004456
Pre-made Human FCER1G/FCRG Lentiviral expression plasmid for FCER1G lentivirus packaging, FCER1G lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
FcRγ/FCER1G/FCERG/FCER1G/FCRG products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP004456 | Human FCER1G Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP004456 |
Gene Name | FCER1G |
Accession Number | NM_004106 |
Gene ID | 2207 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 261 bp |
Gene Alias | FCRG |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGATTCCAGCAGTGGTCTTGCTCTTACTCCTTTTGGTTGAACAAGCAGCGGCCCTGGGAGAGCCTCAGCTCTGCTATATCCTGGATGCCATCCTGTTTCTGTATGGAATTGTCCTCACCCTCCTCTACTGTCGACTGAAGATCCAAGTGCGAAAGGCAGCTATAACCAGCTATGAGAAATCAGATGGTGTTTACACGGGCCTGAGCACCAGGAACCAGGAGACTTACGAGACTCTGAAGCATGAGAAACCACCACAGTAG |
ORF Protein Sequence | MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T95400-Ab | Anti-FCERG/ FCER1G/ FCRG monoclonal antibody |
Target Antigen | GM-Tg-g-T95400-Ag | FCERG/FCER1G VLP (virus-like particle) |
ORF Viral Vector | pGMLP004456 | Human FCER1G Lentivirus plasmid |
ORF Viral Vector | pGMAD000910 | Human FCER1G Adenovirus plasmid |
ORF Viral Vector | vGMLP004456 | Human FCER1G Lentivirus particle |
ORF Viral Vector | vGMAD000910 | Human FCER1G Adenovirus particle |
Target information
Target ID | GM-T95400 |
Target Name | FcRγ/FCER1G/FCERG |
Gene Group Identifier (Target Gene ID in Homo species) |
2207 |
Gene ID |
100034137 (Equus caballus), 101089236 (Felis catus), 14127 (Mus musculus), 2207 (Homo sapiens) 25441 (Rattus norvegicus), 282226 (Bos taurus), 403798 (Canis lupus familiaris), 720291 (Macaca mulatta) |
Gene Symbols & Synonyms | FCER1G,Fcer1g,CD23,Fce1g,Ly-50,FcR[g],FcRgamma,FcR-gamma,FcepsilonRI,FCRG |
Target Alternative Names | FcRγ, FCER1G, FCERG,High affinity immunoglobulin epsilon receptor subunit gamma,Fc receptor gamma-chain (FcRgamma), Fc-epsilon RI-gamma, IgE Fc receptor subunit gamma (FceRI gamma),FCRG |
Uniprot Accession |
P20411,P20491,P30273,Q9BDR7
Additional SwissProt Accessions: P20491,P30273,P20411,Q9BDR7 |
Uniprot Entry Name | |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target |
Disease | |
Disease from KEGG | Sphingolipid signaling pathway, Phospholipase D signaling pathway, Platelet activation, C-type lectin receptor signaling pathway, Natural killer cell mediated cytotoxicity, Fc epsilon RI signaling pathway, Tuberculosis, Asthma |
Gene Ensembl | ENSMUSG00000058715, ENSG00000158869, ENSBTAG00000024503, ENSCAFG00845029387, ENSMMUG00000004512 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.