Human NRG4/HRG4 ORF/cDNA clone-Lentivirus particle (NM_138573)
Cat. No.: vGMLP004430
Pre-made Human NRG4/HRG4 Lentiviral expression plasmid for NRG4 lentivirus packaging, NRG4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
NRG4/HRG4 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP004430 | Human NRG4 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP004430 |
| Gene Name | NRG4 |
| Accession Number | NM_138573 |
| Gene ID | 145957 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 348 bp |
| Gene Alias | HRG4 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCCAACAGATCACGAAGAGCCCTGTGGTCCCAGTCACAAGTCGTTTTGCCTGAATGGGGGGCTTTGTTATGTGATACCTACTATTCCCAGCCCATTTTGTAGGTGCGTTGAAAACTATACAGGAGCTCGTTGTGAAGAGGTTTTTCTCCCAGGCTCCAGCATCCAAACTAAAAGTAACCTGTTTGAAGCTTTTGTGGCATTGGCGGTCCTAGTAACACTTATCATTGGAGCCTTCTACTTCCTTTGCAGGAAAGGCCACTTTCAGAGAGCCAGTTCAGTCCAGTATGATATCAACCTGGTAGAGACGAGCAGTACCAGTGCCCACCACAGTCATGAACAACACTGA |
| ORF Protein Sequence | MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T97314-Ab | Anti-NRG4/ HRG4 monoclonal antibody |
| Target Antigen | GM-Tg-g-T97314-Ag | NRG4 VLP (virus-like particle) |
| Cytokine | cks-Tg-g-GM-T97314 | neuregulin 4 (NRG4) protein & antibody |
| ORF Viral Vector | pGMLP004430 | Human NRG4 Lentivirus plasmid |
| ORF Viral Vector | vGMLP004430 | Human NRG4 Lentivirus particle |
Target information
| Target ID | GM-T97314 |
| Target Name | NRG4 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
145957 |
| Gene ID |
100630158 (Equus caballus), 100848238 (Bos taurus), 101095102 (Felis catus), 111093125 (Canis lupus familiaris) 145957 (Homo sapiens), 690919 (Rattus norvegicus), 707378 (Macaca mulatta), 83961 (Mus musculus) |
| Gene Symbols & Synonyms | NRG4,Nrg4,HRG4 |
| Target Alternative Names | HRG4,NRG4,Nrg4,Pro-NRG4,Pro-neuregulin-4,membrane-bound isoform |
| Uniprot Accession |
Q8WWG1,Q9WTX4
Additional SwissProt Accessions: Q8WWG1,Q9WTX4 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Cytokine Target |
| Disease | |
| Disease from KEGG | ErbB signaling pathway |
| Gene Ensembl | ENSECAG00000026884, ENSBTAG00000048792, ENSG00000169752, ENSMMUG00000020882, ENSMUSG00000032311 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


