Human CALCB/CALC2/CGRP-II ORF/cDNA clone-Lentivirus particle (NM_000728)

Cat. No.: vGMLP004385

Pre-made Human CALCB/CALC2/CGRP-II Lentiviral expression plasmid for CALCB lentivirus packaging, CALCB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CALCB/CALC2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004385 Human CALCB Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004385
Gene Name CALCB
Accession Number NM_000728
Gene ID 797
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 384 bp
Gene Alias CALC2,CGRP-II,CGRP2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGTTTCCGGAAGTTCTCCCCCTTCCTGGCTCTCAGTATCTTGGTCCTGTACCAGGCGGGCAGCCTCCAGGCGGCGCCATTCAGGTCTGCCCTGGAGAGCAGCCCAGACCCGGCCACACTCAGTAAAGAGGACGCGCGCCTCCTGCTGGCTGCACTGGTGCAGGACTATGTGCAGATGAAGGCCAGTGAGCTGAAGCAGGAGCAGGAGACACAGGGCTCCAGCTCCGCTGCCCAGAAGAGAGCCTGCAACACTGCCACCTGTGTGACTCATCGGCTGGCAGGCTTGCTGAGCAGATCAGGGGGCATGGTGAAGAGCAACTTCGTGCCCACCAATGTGGGTTCCAAAGCCTTTGGCAGGCGCCGCAGGGACCTTCAAGCCTGA
ORF Protein Sequence MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-228 Pre-Made Galcanezumab biosimilar, Whole mAb, Anti-CALCA;CALCB Antibody: Anti-CT/KC/PCT/CGRP/CALC1/CGRP1/CGRP-I/CGRP-alpha;CALC2/CGRP-II/CGRP2 therapeutic antibody
    Biosimilar GMP-Bios-ab-191 Pre-Made Eptinezumab biosimilar, Whole mAb, Anti-CALCA;CALCB Antibody: Anti-CT/KC/PCT/CGRP/CALC1/CGRP1/CGRP-I/CGRP-alpha;CALC2/CGRP-II/CGRP2 therapeutic antibody
    Biosimilar GMP-Bios-ab-222 Pre-Made Fremanezumab biosimilar, Whole mAb, Anti-CALCA;CALCB Antibody: Anti-CT/KC/PCT/CGRP/CALC1/CGRP1/CGRP-I/CGRP-alpha;CALC2/CGRP-II/CGRP2 therapeutic antibody
    Target Antibody GM-Tg-g-T09067-Ab Anti-CALCB/ CALC2/ CGRP-II functional antibody
    Target Antigen GM-Tg-g-T09067-Ag CALCB protein
    ORF Viral Vector pGMLP004385 Human CALCB Lentivirus plasmid
    ORF Viral Vector vGMLP004385 Human CALCB Lentivirus particle


    Target information

    Target ID GM-T09067
    Target Name CALCB
    Gene Group Identifier
    （Target Gene ID in Homo species)         		797
    Gene ID 101094539 (Felis catus), 171519 (Rattus norvegicus), 698209 (Macaca mulatta), 797 (Homo sapiens)
    Gene Symbols & Synonyms CALCB,Calcb,CGRP2,CGRP-II,CALC2
    Target Alternative Names Beta-type CGRP (Beta-CGRP),CALC2,CALCB,CGRP-II,CGRP2,Calcb,Calcitonin gene-related peptide 2,Calcitonin gene-related peptide II (CGRP-II)
    Uniprot Accession P10092,P10093
    Additional SwissProt Accessions: P10093,P10092
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, INN Index
    Disease
    Disease from KEGG Neuroactive ligand-receptor interaction, Vascular smooth muscle contraction
    Gene Ensembl ENSMMUG00000020245, ENSG00000175868
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.