Human SCGB1D4/IIS ORF/cDNA clone-Lentivirus particle (NM_206998)

Cat. No.: vGMLP004315

Pre-made Human SCGB1D4/IIS Lentiviral expression plasmid for SCGB1D4 lentivirus packaging, SCGB1D4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to SCGB1D4/IIS products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004315 Human SCGB1D4 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004315
Gene Name SCGB1D4
Accession Number NM_206998
Gene ID 404552
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 252 bp
Gene Alias IIS
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGGCTGTCAGTGTGTCTCCTGATGGTCTCGCTGGCCCTTTGCTGCTACCAGGCCCATGCTCTTGTCTGCCCAGCTGTTGCTTCTGAGATCACAGTCTTCTTATTCTTAAGTGACGCTGCGGTAAACCTCCAAGTTGCCAAACTTAATCCACCTCCAGAAGCTCTTGCAGCCAAGTTGGAAGTGAAGCACTGCACCGATCAGATATCTTTTAAGAAACGACTCTCATTGAAAAAGTCCTGGTGGAAATAG
ORF Protein Sequence MRLSVCLLMVSLALCCYQAHALVCPAVASEITVFLFLSDAAVNLQVAKLNPPPEALAAKLEVKHCTDQISFKKRLSLKKSWWK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1266-Ab Anti-SG1D4/ SCGB1D4/ IIS functional antibody
    Target Antigen GM-Tg-g-SE1266-Ag SCGB1D4 protein
    ORF Viral Vector pGMLP004315 Human SCGB1D4 Lentivirus plasmid
    ORF Viral Vector vGMLP004315 Human SCGB1D4 Lentivirus particle


    Target information

    Target ID GM-SE1266
    Target Name SCGB1D4
    Gene Group Identifier
    （Target Gene ID in Homo species)         		404552
    Gene ID 106993221 (Macaca mulatta), 404552 (Homo sapiens)
    Gene Symbols & Synonyms SCGB1D4,IIS
    Target Alternative Names IFN-gamma-inducible secretoglobin (IIS),IIS,SCGB1D4,Secretoglobin family 1D member 4
    Uniprot Accession Q6XE38
    Additional SwissProt Accessions: Q6XE38
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSG00000197745
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.