Human CTAG1A/CT6.1/ESO1 ORF/cDNA clone-Lentivirus particle (NM_139250)

Cat. No.: vGMLP004299

Pre-made Human CTAG1A/CT6.1/ESO1 Lentiviral expression plasmid for CTAG1A lentivirus packaging, CTAG1A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to NY-ESO-1/CTAG1A/CTAG1A/CT6.1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004299 Human CTAG1A Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004299
Gene Name CTAG1A
Accession Number NM_139250
Gene ID 246100
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 543 bp
Gene Alias CT6.1,ESO1,LAGE-2,LAGE2A,NY-ESO-1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGGCCGAAGGCCGGGGCACAGGGGGTTCGACGGGCGATGCTGATGGCCCAGGAGGCCCTGGCATTCCTGATGGCCCAGGGGGCAATGCTGGCGGCCCAGGAGAGGCGGGTGCCACGGGCGGCAGAGGTCCCCGGGGCGCAGGGGCAGCAAGGGCCTCGGGGCCGGGAGGAGGCGCCCCGCGGGGTCCGCATGGCGGCGCGGCTTCAGGGCTGAATGGATGCTGCAGATGCGGGGCCAGGGGGCCGGAGAGCCGCCTGCTTGAGTTCTACCTCGCCATGCCTTTCGCGACACCCATGGAAGCAGAGCTGGCCCGCAGGAGCCTGGCCCAGGATGCCCCACCGCTTCCCGTGCCAGGGGTGCTTCTGAAGGAGTTCACTGTGTCCGGCAACATACTGACTATCCGACTGACTGCTGCAGACCACCGCCAACTGCAGCTCTCCATCAGCTCCTGTCTCCAGCAGCTTTCCCTGTTGATGTGGATCACGCAGTGCTTTCTGCCCGTGTTTTTGGCTCAGCCTCCCTCAGGGCAGAGGCGCTAA
ORF Protein Sequence MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T82277-Ab Anti-NY-ESO-1 monoclonal antibody
    Target Antigen GM-Tg-g-T82277-Ag NY-ESO-1/CTAG1A protein
    ORF Viral Vector pGMLP004299 Human CTAG1A Lentivirus plasmid
    ORF Viral Vector pGMLP004592 Human CTAG1B Lentivirus plasmid
    ORF Viral Vector pGMLV002233 Human CTAG1B Lentivirus plasmid
    ORF Viral Vector vGMLP004299 Human CTAG1A Lentivirus particle
    ORF Viral Vector vGMLP004592 Human CTAG1B Lentivirus particle
    ORF Viral Vector vGMLV002233 Human CTAG1B Lentivirus particle


    Target information

    Target ID GM-T82277
    Target Name NY-ESO-1/CTAG1A
    Gene Group Identifier
    (Target Gene ID in Homo species)
    246100
    Gene ID 246100 (Homo sapiens)
    Gene Symbols & Synonyms CTAG1A,ESO1,CT6.1,LAGE-2,LAGE2A,NY-ESO-1
    Target Alternative Names Autoimmunogenic cancer/testis antigen NY-ESO-1,CT6.1,CTAG1A,Cancer/testis antigen 1,Cancer/testis antigen 6.1 (CT6.1),ESO1,L antigen family member 2 (LAGE-2),LAGE-2,LAGE2A,NY-ESO-1
    Uniprot Accession P78358
    Additional SwissProt Accessions: P78358
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease
    Disease from KEGG
    Gene Ensembl ENSG00000268651
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.