Human ARL15/ARFRP2 ORF/cDNA clone-Lentivirus particle (NM_019087)
Cat. No.: vGMLP004214
Pre-made Human ARL15/ARFRP2 Lentiviral expression plasmid for ARL15 lentivirus packaging, ARL15 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
ARL15/ARFRP2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP004214 | Human ARL15 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP004214 |
| Gene Name | ARL15 |
| Accession Number | NM_019087 |
| Gene ID | 54622 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 615 bp |
| Gene Alias | ARFRP2 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTCTGATCTCCGAATAACTGAGGCGTTTCTGTACATGGATTATCTGTGTTTTAGAGCACTTTGCTGCAAGGGACCACCACCTGCACGACCAGAATATGACCTGGTTTGCATAGGCCTCACAGGTTCTGGCAAAACCAGTCTGTTGTCCAAACTCTGCAGTGAAAGCCCCGATAACGTCGTGTCGACCACAGGTTTTAGTATTAAAGCAGTGCCATTCCAGAATGCCATCTTGAATGTAAAAGAACTTGGAGGGGCTGATAACATCCGGAAATACTGGAGCCGCTACTACCAAGGATCTCAAGGGGTAATATTTGTATTAGACAGTGCCTCTTCAGAGGATGATTTAGAAGCTGCTAGAAATGAGCTGCACTCAGCTCTTCAGCATCCACAGTTATGCACTTTACCCTTTTTAATATTGGCCAATCATCAAGACAAGCCAGCAGCTCGCTCAGTACAAGAGATCAAAAAATATTTTGAACTTGAACCACTTGCACGTGGAAAACGCTGGATTCTACAGCCCTGCTCACTGGATGACATGGATGCACTGAAAGACAGCTTCTCTCAGCTGATTAATTTGTTAGAAGAAAAAGACCATGAAGCTGTAAGAATGTGA |
| ORF Protein Sequence | MSDLRITEAFLYMDYLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEEKDHEAVRM |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP2357-Ab | Anti-ARL15 monoclonal antibody |
| Target Antigen | GM-Tg-g-IP2357-Ag | ARL15 protein |
| ORF Viral Vector | pGMLP004214 | Human ARL15 Lentivirus plasmid |
| ORF Viral Vector | vGMLP004214 | Human ARL15 Lentivirus particle |
Target information
| Target ID | GM-IP2357 |
| Target Name | ARL15 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
54622 |
| Gene ID |
100062980 (Equus caballus), 101088982 (Felis catus), 218639 (Mus musculus), 489204 (Canis lupus familiaris) 534329 (Bos taurus), 54622 (Homo sapiens), 689079 (Rattus norvegicus), 707840 (Macaca mulatta) |
| Gene Symbols & Synonyms | ARL15,Arl15,Arfrp2,A430036I03,C230032K13Rik,ARFRP2 |
| Target Alternative Names | A430036I03,ADP-ribosylation factor-like protein 15,ADP-ribosylation factor-related protein 2 (ARF-related protein 2),ARFRP2,ARL15,Arfrp2,Arl15,C230032K13Rik |
| Uniprot Accession |
Q5EA19,Q8BGR6,Q9NXU5
Additional SwissProt Accessions: Q8BGR6,Q5EA19,Q9NXU5 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | |
| Disease | |
| Disease from KEGG | |
| Gene Ensembl | ENSECAG00000014970, ENSMUSG00000042348, ENSCAFG00845000266, ENSBTAG00000019834, ENSG00000185305, ENSMMUG00000011995 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


