Human ARL15/ARFRP2 ORF/cDNA clone-Lentivirus particle (NM_019087)

Cat. No.: vGMLP004214

Pre-made Human ARL15/ARFRP2 Lentiviral expression plasmid for ARL15 lentivirus packaging, ARL15 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to ARL15/ARFRP2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004214 Human ARL15 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004214
Gene Name ARL15
Accession Number NM_019087
Gene ID 54622
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 615 bp
Gene Alias ARFRP2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTGATCTCCGAATAACTGAGGCGTTTCTGTACATGGATTATCTGTGTTTTAGAGCACTTTGCTGCAAGGGACCACCACCTGCACGACCAGAATATGACCTGGTTTGCATAGGCCTCACAGGTTCTGGCAAAACCAGTCTGTTGTCCAAACTCTGCAGTGAAAGCCCCGATAACGTCGTGTCGACCACAGGTTTTAGTATTAAAGCAGTGCCATTCCAGAATGCCATCTTGAATGTAAAAGAACTTGGAGGGGCTGATAACATCCGGAAATACTGGAGCCGCTACTACCAAGGATCTCAAGGGGTAATATTTGTATTAGACAGTGCCTCTTCAGAGGATGATTTAGAAGCTGCTAGAAATGAGCTGCACTCAGCTCTTCAGCATCCACAGTTATGCACTTTACCCTTTTTAATATTGGCCAATCATCAAGACAAGCCAGCAGCTCGCTCAGTACAAGAGATCAAAAAATATTTTGAACTTGAACCACTTGCACGTGGAAAACGCTGGATTCTACAGCCCTGCTCACTGGATGACATGGATGCACTGAAAGACAGCTTCTCTCAGCTGATTAATTTGTTAGAAGAAAAAGACCATGAAGCTGTAAGAATGTGA
ORF Protein Sequence MSDLRITEAFLYMDYLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEEKDHEAVRM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2357-Ab Anti-ARL15 monoclonal antibody
    Target Antigen GM-Tg-g-IP2357-Ag ARL15 protein
    ORF Viral Vector pGMLP004214 Human ARL15 Lentivirus plasmid
    ORF Viral Vector vGMLP004214 Human ARL15 Lentivirus particle


    Target information

    Target ID GM-IP2357
    Target Name ARL15
    Gene Group Identifier
    (Target Gene ID in Homo species)
    54622
    Gene ID 100062980 (Equus caballus), 101088982 (Felis catus), 218639 (Mus musculus), 489204 (Canis lupus familiaris)
    534329 (Bos taurus), 54622 (Homo sapiens), 689079 (Rattus norvegicus), 707840 (Macaca mulatta)
    Gene Symbols & Synonyms ARL15,Arl15,Arfrp2,A430036I03,C230032K13Rik,ARFRP2
    Target Alternative Names A430036I03,ADP-ribosylation factor-like protein 15,ADP-ribosylation factor-related protein 2 (ARF-related protein 2),ARFRP2,ARL15,Arfrp2,Arl15,C230032K13Rik
    Uniprot Accession Q5EA19,Q8BGR6,Q9NXU5
    Additional SwissProt Accessions: Q8BGR6,Q5EA19,Q9NXU5
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000014970, ENSMUSG00000042348, ENSCAFG00845000266, ENSBTAG00000019834, ENSG00000185305, ENSMMUG00000011995
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.