Human MEPCE ORF/cDNA clone-Lentivirus particle (BC016396.1)

Cat. No.: vGMLP004022

Pre-made Human MEPCE/ Lentiviral expression plasmid for MEPCE lentivirus packaging, MEPCE lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to MEPCE products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004022 Human MEPCE Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004022
Gene Name MEPCE
Accession Number BC016396.1
Gene ID 56257
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 663 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTGGGCCTGGATATCGATTCCCGGCTCATCCATTCTGCCCGCCAAAACATCCGACACTACCTTTCCGAGGAGCTGCGTCTCCCACCCCAGACTTTGGAAGGGGACCCGGGGGCAGAGGGTGAGGAAGGGACCACCACCGTTCGAAAGAGGAGCTGCTTCCCAGCCTCGCTGACTGCCAGCCGGGGTCCCATCGCTGCCCCCCAAGTGCCCTTGGATGGAGCGGACACATCAGTCTTCCCCAACAATGTTGTCTTCGTCACGGGTAATTATGTGCTGGATCGAGATGACCTGGTGGAGGCCCAAACACCTGAGTATGATGTGGTGCTCTGCCTCAGCCTCACCAAGTGGGTGCATCTGAACTGGGGAGACGAGGGCCTGAAGCGCATGTTTCGCCGGATCTACCGGCACCTACGCCCTGGGGGCATCCTGGTCCTAGAGCCCCAACCCTGGTCGTCGTATGGCAAGAGAAAGACTCTTACAGAAACGATCTACAAGAACTACTACCGAATCCAATTGAAGCCAGAGCAGTTCAGTTCCTACCTGACATCCCCAGACGTGGGCTTCTCCAGCTATGAGCTTGTGGCCACACCCCACAACACCTCTAAAGGCTTCCAGCGTCCTGTGTACCTGTTCCACAAGGCCCGATCCCCCAGCCACTAA
ORF Protein Sequence MVGLDIDSRLIHSARQNIRHYLSEELRLPPQTLEGDPGAEGEEGTTTVRKRSCFPASLTASRGPIAAPQVPLDGADTSVFPNNVVFVTGNYVLDRDDLVEAQTPEYDVVLCLSLTKWVHLNWGDEGLKRMFRRIYRHLRPGGILVLEPQPWSSYGKRKTLTETIYKNYYRIQLKPEQFSSYLTSPDVGFSSYELVATPHNTSKGFQRPVYLFHKARSPSH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2594-Ab Anti-MEPCE monoclonal antibody
    Target Antigen GM-Tg-g-IP2594-Ag MEPCE protein
    ORF Viral Vector pGMLP004022 Human MEPCE Lentivirus plasmid
    ORF Viral Vector vGMLP004022 Human MEPCE Lentivirus particle


    Target information

    Target ID GM-IP2594
    Target Name MEPCE
    Gene Group Identifier
    (Target Gene ID in Homo species)
    56257
    Gene ID 100068939 (Equus caballus), 101090162 (Felis catus), 231803 (Mus musculus), 304361 (Rattus norvegicus)
    489839 (Canis lupus familiaris), 519969 (Bos taurus), 56257 (Homo sapiens), 711829 (Macaca mulatta)
    Gene Symbols & Synonyms MEPCE,Mepce,Bcdin3,D5Wsu46e,BCDIN3
    Target Alternative Names 7SK snRNA methylphosphate capping enzyme,BCDIN3,Bcdin3,Bicoid-interacting protein 3 homolog (Bin3 homolog),D5Wsu46e,MEPCE,MePCE,Mepce
    Uniprot Accession Q7L2J0,Q8K3A9
    Additional SwissProt Accessions: Q8K3A9,Q7L2J0
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000024124, ENSMUSG00000029726, ENSCAFG00845001979, ENSBTAG00000016763, ENSG00000146834, ENSMMUG00000012724
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.