Human GHRL/MTLRP ORF/cDNA clone-Lentivirus particle (BC025791)

Cat. No.: vGMLP003977

Pre-made Human GHRL/MTLRP Lentiviral expression plasmid for GHRL lentivirus packaging, GHRL lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to GHRL/MTLRP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003977 Human GHRL Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003977
Gene Name GHRL
Accession Number BC025791
Gene ID 51738
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 354 bp
Gene Alias MTLRP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCCTCCCCAGGGACCGTCTGCAGCCTCCTGCTCCTCGGCATGCTCTGGCTGGACTTGGCCATGGCAGGCTCCAGCTTCCTGAGCCCTGAACACCAGAGAGTCCAGCAGAGAAAGGAGTCGAAGAAGCCACCAGCCAAGCTGCAGCCCCGAGCTCTAGCAGGCTGGCTCCGCCCGGAAGATGGAGGTCAAGCAGAAGGGGCAGAGGATGAAATGGAAGTCCGGTTCAACGCCCCCTTTGATGTTGGAATCAAGCTGTCAGGGGTTCAGTACCAGCAGCACAGCCAGGCCCTGGGGAAGTTTCTTCAGGACATCCTCTGGGAAGAGGCCAAAGAGGCCCCAGCCGACAAGTGA
ORF Protein Sequence MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T06850-Ab Anti-GHRL/ MTLRP functional antibody
    Target Antigen GM-Tg-g-T06850-Ag GHRL protein
    ORF Viral Vector pGMLP003977 Human GHRL Lentivirus plasmid
    ORF Viral Vector vGMLP003977 Human GHRL Lentivirus particle


    Target information

    Target ID GM-T06850
    Target Name GHRL
    Gene Group Identifier
    （Target Gene ID in Homo species)         		51738
    Gene ID 100058008 (Equus caballus), 281192 (Bos taurus), 403587 (Canis lupus familiaris), 493844 (Felis catus)
    51738 (Homo sapiens), 574280 (Macaca mulatta), 58991 (Mus musculus), 59301 (Rattus norvegicus)
    Gene Symbols & Synonyms GHRL,Ghrl,Gh1-1,ghrelin,MTLRP,MTLRP-AP,Ghr,m46,MTLRPAP,2210006E23Rik
    Target Alternative Names 2210006E23Rik,Appetite-regulating hormone,GHRL,Gh1-1,Ghr,Ghrl,Growth hormone secretagogue,Growth hormone-releasing peptide,MTLRP,MTLRP-AP,MTLRPAP,Motilin-related peptide,Protein M46,ghrelin,m46
    Uniprot Accession Q6BEG6,Q9BDJ6,Q9BEF8,Q9EQX0,Q9QYH7,Q9UBU3
    Additional SwissProt Accessions: Q9BDJ6,Q9BEF8,Q6BEG6,Q9UBU3,Q9EQX0,Q9QYH7
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease
    Disease from KEGG cAMP signaling pathway, Neuroactive ligand-receptor interaction, Growth hormone synthesis, secretion and action
    Gene Ensembl ENSECAG00000025073, ENSBTAG00000012328, ENSCAFG00845007901, ENSG00000157017, ENSMUSG00000064177
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.