Human MMP7/MMP-7/MPSL1 ORF/cDNA clone-Lentivirus particle (NM_002423)
Cat. No.: vGMLP003953
Pre-made Human MMP7/MMP-7/MPSL1 Lentiviral expression plasmid for MMP7 lentivirus packaging, MMP7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
MMP7/MMP-7/MMP7/MMP-7 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP003953 | Human MMP7 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP003953 |
| Gene Name | MMP7 |
| Accession Number | NM_002423 |
| Gene ID | 4316 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 804 bp |
| Gene Alias | MMP-7,MPSL1,PUMP-1 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCGACTCACCGTGCTGTGTGCTGTGTGCCTGCTGCCTGGCAGCCTGGCCCTGCCGCTGCCTCAGGAGGCGGGAGGCATGAGTGAGCTACAGTGGGAACAGGCTCAGGACTATCTCAAGAGATTTTATCTCTATGACTCAGAAACAAAAAATGCCAACAGTTTAGAAGCCAAACTCAAGGAGATGCAAAAATTCTTTGGCCTACCTATAACTGGAATGTTAAACTCCCGCGTCATAGAAATAATGCAGAAGCCCAGATGTGGAGTGCCAGATGTTGCAGAATACTCACTATTTCCAAATAGCCCAAAATGGACTTCCAAAGTGGTCACCTACAGGATCGTATCATATACTCGAGACTTACCGCATATTACAGTGGATCGATTAGTGTCAAAGGCTTTAAACATGTGGGGCAAAGAGATCCCCCTGCATTTCAGGAAAGTTGTATGGGGAACTGCTGACATCATGATTGGCTTTGCGCGAGGAGCTCATGGGGACTCCTACCCATTTGATGGGCCAGGAAACACGCTGGCTCATGCCTTTGCGCCTGGGACAGGTCTCGGAGGAGATGCTCACTTCGATGAGGATGAACGCTGGACGGATGGTAGCAGTCTAGGGATTAACTTCCTGTATGCTGCAACTCATGAACTTGGCCATTCTTTGGGTATGGGACATTCCTCTGATCCTAATGCAGTGATGTATCCAACCTATGGAAATGGAGATCCCCAAAATTTTAAACTTTCCCAGGATGATATTAAAGGCATTCAGAAACTATATGGAAAGAGAAGTAATTCAAGAAAGAAATAG |
| ORF Protein Sequence | MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T73475-Ab | Anti-MMP7/ MMP-7/ MPSL1 functional antibody |
| Target Antigen | GM-Tg-g-T73475-Ag | MMP-7/MMP7 protein |
| ORF Viral Vector | pGMLP003953 | Human MMP7 Lentivirus plasmid |
| ORF Viral Vector | pGMLV002265 | Human MMP7 Lentivirus plasmid |
| ORF Viral Vector | pGMPC000761 | Human MMP7 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP003953 | Human MMP7 Lentivirus particle |
| ORF Viral Vector | vGMLV002265 | Human MMP7 Lentivirus particle |
Target information
| Target ID | GM-T73475 |
| Target Name | MMP7/MMP-7 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
4316 |
| Gene ID |
100068985 (Equus caballus), 17393 (Mus musculus), 25335 (Rattus norvegicus), 286794 (Bos taurus) 4316 (Homo sapiens), 489432 (Canis lupus familiaris), 703072 (Macaca mulatta), 727698 (Felis catus) |
| Gene Symbols & Synonyms | MMP7,Mmp7,MAT,MMP-7,MPMM,MPSL1,PUMP-1,Matrilysin |
| Target Alternative Names | MAT,MMP-7,MMP7,MPMM,MPSL1,Matrilysin,Matrin,Matrix metalloproteinase-7 (MMP-7),Mmp7,PUMP-1,Pump-1 protease,Uterine metalloproteinase |
| Uniprot Accession |
P09237,P50280,P55032,Q10738
Additional SwissProt Accessions: Q10738,P50280,P09237,P55032 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target |
| Disease | cancer, Ovary Cancer, Chronic Kidney Disease |
| Disease from KEGG | Wnt signaling pathway, Human T-cell leukemia virus 1 infection |
| Gene Ensembl | ENSECAG00000021262, ENSMUSG00000018623, ENSBTAG00000004594, ENSG00000137673, ENSCAFG00845000992, ENSMMUG00000003405 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


