Human BTC ORF/cDNA clone-Lentivirus particle (BC011618)

Cat. No.: vGMLP003911

Pre-made Human BTC/ Lentiviral expression plasmid for BTC lentivirus packaging, BTC lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to BTC products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003911 Human BTC Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003911
Gene Name BTC
Accession Number BC011618
Gene ID 685
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 537 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGACCGGGCCGCCCGGTGCAGCGGCGCCAGCTCCCTGCCACTGCTCCTGGCCCTTGCCCTGGGTCTAGTGATCCTTCACTGTGTGGTGGCAGATGGGAATTCCACCAGAAGTCCTGAAACTAATGGCCTCCTCTGTGGAGACCCTGAGGAAAACTGTGCAGCTACCACCACACAATCAAAGCGGAAAGGCCACTTCTCTAGGTGCCCCAAGCAATACAAGCATTACTGCATCAAAGGGAGATGCCGCTTCGTGGTGGCCGAGCAGACGCCCTCCTGTGTCTGTGATGAAGGCTACATTGGAGCAAGGTGTGAGAGAGTTGACTTGTTTTACCTAAGAGGAGACAGAGGACAGATTCTGGTGATTTGTATGATAGCAGTTATGGTAGTTTTTATTATTTTGGTCATCGGTGTCTGCACATGCTGTCACCCTCTTCGGAAACGTCGTAAAAGAAAGAAGAAAGAAGAAGAAATGGAAACTCTGGGTAAAGATATAACTCCTATCAATGAAGATATTGAAGAGACAAATATTGCTTAA
ORF Protein Sequence MDRAARCSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICMIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0142-Ab Anti-BTC monoclonal antibody
    Target Antigen GM-Tg-g-MP0142-Ag BTC VLP (virus-like particle)
    Cytokine cks-Tg-g-GM-MP0142 betacellulin (BTC) protein & antibody
    ORF Viral Vector pGMLP003424 Human BTC Lentivirus plasmid
    ORF Viral Vector pGMLP003911 Human BTC Lentivirus plasmid
    ORF Viral Vector vGMLP003424 Human BTC Lentivirus particle
    ORF Viral Vector vGMLP003911 Human BTC Lentivirus particle


    Target information

    Target ID GM-MP0142
    Target Name BTC
    Gene Group Identifier
    （Target Gene ID in Homo species)         		685
    Gene ID 100056845 (Equus caballus), 101092850 (Felis catus), 12223 (Mus musculus), 280737 (Bos taurus)
    482682 (Canis lupus familiaris), 64022 (Rattus norvegicus), 685 (Homo sapiens), 702178 (Macaca mulatta)
    Gene Symbols & Synonyms BTC,Btc,Bcn
    Target Alternative Names BTC,Bcn,Btc,Probetacellulin
    Uniprot Accession P35070,Q05928,Q9TTC5
    Additional SwissProt Accessions: Q05928,Q9TTC5,P35070
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Cytokine Target
    Disease
    Disease from KEGG ErbB signaling pathway
    Gene Ensembl ENSMUSG00000082361, ENSBTAG00000004237, ENSCAFG00845009447, ENSG00000174808, ENSMMUG00000055714
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.