Human CCL24/Ckb-6/MPIF-2 ORF/cDNA clone-Lentivirus particle (NM_002991)

Cat. No.: vGMLP003812

Pre-made Human CCL24/Ckb-6/MPIF-2 Lentiviral expression plasmid for CCL24 lentivirus packaging, CCL24 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CCL24/Eotaxin 2/CCL24/Ckb-6 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003812 Human CCL24 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003812
Gene Name CCL24
Accession Number NM_002991
Gene ID 6369
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 360 bp
Gene Alias Ckb-6,MPIF-2,MPIF2,SCYA24
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAGGCCTGATGACCATAGTAACCAGCCTTCTGTTCCTTGGTGTCTGTGCCCACCACATCATCCCTACGGGCTCTGTGGTCATCCCCTCTCCCTGCTGCATGTTCTTTGTTTCCAAGAGAATTCCTGAGAACCGAGTGGTCAGCTACCAGCTGTCCAGCAGGAGCACATGCCTCAAGGCAGGAGTGATCTTCACCACCAAGAAGGGCCAGCAGTTCTGTGGCGACCCCAAGCAGGAGTGGGTCCAGAGGTACATGAAGAACCTGGACGCCAAGCAGAAGAAGGCTTCCCCTAGGGCCAGGGCAGTGGCTGTCAAGGGCCCTGTCCAGAGATATCCTGGCAACCAAACCACCTGCTAA
ORF Protein Sequence MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0070-Ab Anti-CCL24/ Ckb-6/ MPIF-2 functional antibody
    Target Antigen GM-Tg-g-SE0070-Ag CCL24 protein
    Cytokine cks-Tg-g-GM-SE0070 chemokine (C-C motif) ligand 24 (CCL24) protein & antibody
    ORF Viral Vector pGMLP003812 Human CCL24 Lentivirus plasmid
    ORF Viral Vector vGMLP003812 Human CCL24 Lentivirus particle


    Target information

    Target ID GM-SE0070
    Target Name CCL24/Eotaxin 2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    6369
    Gene ID 100061208 (Equus caballus), 101086275 (Felis catus), 288593 (Rattus norvegicus), 445452 (Canis lupus familiaris)
    56221 (Mus musculus), 617258 (Bos taurus), 6369 (Homo sapiens), 716050 (Macaca mulatta)
    Gene Symbols & Synonyms CCL24,Ccl24,CKb-6,MPIF-2,Scya24,Ckb-6,MPIF2,SCYA24
    Target Alternative Names CCL24, Eotaxin 2,C-C motif chemokine 24,CK-beta-6, Eosinophil chemotactic protein 2 (Eotaxin-2), Myeloid progenitor inhibitory factor 2 (MPIF-2), Small-inducible cytokine A24,Ckb-6,MPIF2,MPIF-2,SCYA24
    Uniprot Accession O00175,Q68Y86,Q9JKC0
    Additional SwissProt Accessions: Q68Y86,Q9JKC0,O00175
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway
    Gene Ensembl ENSECAG00000032357, ENSCAFG00845004068, ENSMUSG00000004814, ENSBTAG00000026275, ENSG00000106178, ENSMMUG00000058798
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.