Human GPR20 ORF/cDNA clone-Lentivirus particle (NM_005293)

Cat. No.: vGMLP003584

Pre-made Human GPR20/ Lentiviral expression plasmid for GPR20 lentivirus packaging, GPR20 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to GPR20 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003584 Human GPR20 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003584
Gene Name GPR20
Accession Number NM_005293
Gene ID 2843
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 1077 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCCTCTGTGTCTCCAGCGGGGCCCTCGGCCGGGGCAGTCCCCAATGCCACCGCAGTGACAACAGTGCGGACCAATGCCAGCGGGCTGGAGGTGCCCCTGTTCCACCTGTTTGCCCGGCTGGACGAGGAGCTGCATGGCACCTTCCCAGGCCTGTGGCTGGCGCTGATGGCGGTGCACGGAGCCATCTTCCTGGCAGGGCTGGTGCTCAACGGGCTGGCGCTGTACGTCTTCTGCTGCCGCACCCGGGCCAAGACACCCTCAGTCATCTACACCATCAACCTGGTGGTGACCGATCTACTGGTAGGGCTGTCCCTGCCCACGCGCTTCGCTGTGTACTACGGCGCCAGGGGCTGCCTGCGCTGTGCCTTCCCGCACGTCCTCGGTTACTTCCTCAACATGCACTGCTCCATCCTCTTCCTCACCTGCATCTGCGTGGACCGCTACCTGGCCATCGTGCGGCCCGAAGGCTCCCGCCGCTGCCGCCAGCCTGCCTGTGCCAGGGCCGTGTGCGCCTTCGTGTGGCTGGCCGCCGGTGCCGTCACCCTGTCGGTGCTGGGCGTGACAGGCAGCCGGCCCTGCTGCCGTGTCTTTGCGCTGACTGTCCTGGAGTTCCTGCTGCCCCTGCTGGTCATCAGCGTGTTTACCGGCCGCATCATGTGTGCACTGTCGCGGCCGGGTCTGCTCCACCAGGGTCGCCAGCGCCGCGTGCGGGCCATGCAGCTCCTGCTCACGGTGCTCATCATCTTTCTCGTCTGCTTCACGCCCTTCCACGCCCGCCAAGTGGCCGTGGCGCTGTGGCCCGACATGCCACACCACACGAGCCTCGTGGTCTACCACGTGGCCGTGACCCTCAGCAGCCTCAACAGCTGCATGGACCCCATCGTCTACTGCTTCGTCACCAGTGGCTTCCAGGCCACCGTCCGAGGCCTCTTCGGCCAGCACGGAGAGCGTGAGCCCAGCAGCGGTGACGTGGTCAGCATGCACAGGAGCTCCAAGGGCTCAGGCCGTCATCACATCCTCAGTGCCGGCCCTCACGCCCTCACCCAGGCCCTGGCTAATGGGCCCGAGGCTTAG
ORF Protein Sequence MPSVSPAGPSAGAVPNATAVTTVRTNASGLEVPLFHLFARLDEELHGTFPGLWLALMAVHGAIFLAGLVLNGLALYVFCCRTRAKTPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLRCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGVTGSRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLHQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHTSLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGPEA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T65429-Ab Anti-GPR20 monoclonal antibody
    Target Antigen GM-Tg-g-T65429-Ag GPR20 VLP (virus-like particle)
    ORF Viral Vector pGMLP003584 Human GPR20 Lentivirus plasmid
    ORF Viral Vector vGMLP003584 Human GPR20 Lentivirus particle


    Target information

    Target ID GM-T65429
    Target Name GPR20
    Gene Group Identifier
    (Target Gene ID in Homo species)
    2843
    Gene ID 100069651 (Equus caballus), 109496266 (Felis catus), 239530 (Mus musculus), 2843 (Homo sapiens)
    482061 (Canis lupus familiaris), 515695 (Bos taurus), 60667 (Rattus norvegicus), 693582 (Macaca mulatta)
    Gene Symbols & Synonyms GPR20,Gpr20,A430106B11Rik,P2Y4,Gpcr5-1
    Target Alternative Names GPR20,G-protein coupled receptor 20
    Uniprot Accession Q8BYC4,Q99678
    Additional SwissProt Accessions: Q8BYC4,Q99678
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000006027, ENSMUSG00000045281, ENSG00000204882, ENSCAFG00845013261, ENSBTAG00000015985, ENSMMUG00000049586
    Target Classification GPCR


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.