Human EGFL7/NEU1/VE-STATIN ORF/cDNA clone-Lentivirus particle (NM_201446)

Cat. No.: vGMLP003495

Pre-made Human EGFL7/NEU1/VE-STATIN Lentiviral expression plasmid for EGFL7 lentivirus packaging, EGFL7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to EGFL7/NEU1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003495 Human EGFL7 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003495
Gene Name EGFL7
Accession Number NM_201446
Gene ID 51162
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 822 bp
Gene Alias NEU1,VE-STATIN,ZNEU1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGGGGCTCTCAGGAGGTGCTGCTGATGTGGCTTCTGGTGTTGGCAGTGGGCGGCACAGAGCACGCCTACCGGCCCGGCCGTAGGGTGTGTGCTGTCCGGGCTCACGGGGACCCTGTCTCCGAGTCGTTCGTGCAGCGTGTGTACCAGCCCTTCCTCACCACCTGCGACGGGCACCGGGCCTGCAGCACCTACCGAACCATCTATAGGACCGCCTACCGCCGCAGCCCTGGGCTGGCCCCTGCCAGGCCTCGCTACGCGTGCTGCCCCGGCTGGAAGAGGACCAGCGGGCTTCCTGGGGCCTGTGGAGCAGCAATATGCCAGCCGCCATGCCGGAACGGAGGGAGCTGTGTCCAGCCTGGCCGCTGCCGCTGCCCTGCAGGATGGCGGGGTGACACTTGCCAGTCAGATGTGGATGAATGCAGTGCTAGGAGGGGCGGCTGTCCCCAGCGCTGCGTCAACACCGCCGGCAGTTACTGGTGCCAGTGTTGGGAGGGGCACAGCCTGTCTGCAGACGGTACACTCTGTGTGCCCAAGGGAGGGCCCCCCAGGGTGGCCCCCAACCCGACAGGAGTGGACAGTGCAATGAAGGAAGAAGTGCAGAGGCTGCAGTCCAGGGTGGACCTGCTGGAGGAGAAGCTGCAGCTGGTGCTGGCCCCACTGCACAGCCTGGCCTCGCAGGCACTGGAGCATGGGCTCCCGGACCCCGGCAGCCTCCTGGTGCACTCCTTCCAGCAGCTCGGCCGCATCGACTCCCTGAGCGAGCAGATTTCCTTCCTGGAGGAGCAGCTGGGGTCCTGCTCCTGCAAGAAAGACTCGTGA
ORF Protein Sequence MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-428 Pre-Made Parsatuzumab biosimilar, Whole mAb, Anti-EGFL7 Antibody: Anti-NEU1/VE-STATIN/ZNEU1 therapeutic antibody
    Target Antibody GM-Tg-g-T40010-Ab Anti-EGFL7/ NEU1/ VE-STATIN functional antibody
    Target Antigen GM-Tg-g-T40010-Ag EGFL7 protein
    Cytokine cks-Tg-g-GM-T40010 EGF-like-domain, multiple 7 (EGFL7) protein & antibody
    ORF Viral Vector pGMLP003495 Human EGFL7 Lentivirus plasmid
    ORF Viral Vector vGMLP003495 Human EGFL7 Lentivirus particle


    Target information

    Target ID GM-T40010
    Target Name EGFL7
    Gene Group Identifier
    (Target Gene ID in Homo species)
    51162
    Gene ID 100066378 (Equus caballus), 101089659 (Felis catus), 245963 (Rattus norvegicus), 353156 (Mus musculus)
    491250 (Canis lupus familiaris), 51162 (Homo sapiens), 613671 (Bos taurus), 709840 (Macaca mulatta)
    Gene Symbols & Synonyms EGFL7,Egfl7,Zneu1,VE-statin,NEU1,ZNEU1,VE-STATIN
    Target Alternative Names EGF-like protein 7,EGFL7,Egfl7,Epidermal growth factor-like protein 7,Multiple epidermal growth factor-like domains protein 7 (Multiple EGF-like domains protein 7),NEU1,NOTCH4-like protein,VE-STATIN,VE-statin,Vascular endothelial statin (VE-statin),ZNEU1,Zneu1
    Uniprot Accession Q6AZ60,Q9QXT5,Q9UHF1
    Additional SwissProt Accessions: Q6AZ60,Q9QXT5,Q9UHF1
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, INN Index, Cytokine Target
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000015593, ENSMUSG00000026921, ENSCAFG00845005400, ENSG00000172889, ENSBTAG00000030278, ENSMMUG00000026981
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.