Human MPDU1/CDGIF/HBEBP2BPA ORF/cDNA clone-Lentivirus particle (NM_004870)

Cat. No.: vGMLP003484

Pre-made Human MPDU1/CDGIF/HBEBP2BPA Lentiviral expression plasmid for MPDU1 lentivirus packaging, MPDU1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to MPDU1/CDGIF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003484 Human MPDU1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003484
Gene Name MPDU1
Accession Number NM_004870
Gene ID 9526
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 744 bp
Gene Alias CDGIF,HBEBP2BPA,Lec35,My008,PP3958,PQLC5,SL15
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCCGAGGCGGACGGACCGCTTAAACGGCTGCTCGTGCCGATTCTTTTACCTGAGAAATGCTACGACCAACTTTTCGTTCAGTGGGACTTGCTTCACGTCCCCTGCCTCAAGATTCTCCTCAGCAAAGGCCTGGGGCTGGGCATTGTGGCTGGCTCACTTCTAGTAAAGCTGCCCCAGGTGTTTAAAATCCTGGGAGCCAAGAGTGCTGAAGGGTTGAGTCTCCAGTCTGTAATGCTGGAGCTAGTGGCATTGACTGGGACCATGGTCTACAGCATCACTAACAACTTCCCATTCAGCTCTTGGGGTGAAGCCTTATTCCTGATGCTCCAGACGATCACCATCTGCTTCCTGGTCATGCACTACAGAGGACAGACTGTGAAAGGTGTCGCTTTCCTCGCTTGCTACGGCCTGGTCCTGCTGGTGCTTCTCTCACCTCTGACGCCCTTGACTGTAGTCACCCTGCTCCAGGCCTCCAATGTGCCTGCTGTGGTGGTGGGGAGGCTTCTCCAGGCAGCCACCAACTACCACAACGGGCACACAGGCCAGCTCTCAGCCATCACAGTCTTCCTGCTGTTTGGGGGCTCCCTGGCCCGAATCTTCACTTCCATTCAGGAAACCGGAGATCCCCTGATGGCTGGGACCTTTGTGGTCTCCTCTCTCTGCAACGGCCTCATCGCCGCCCAGCTGCTCTTCTACTGGAATGCAAAGCCTCCCCACAAGCAGAAAAAGGCGCAGTAG
ORF Protein Sequence MAAEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSKGLGLGIVAGSLLVKLPQVFKILGAKSAEGLSLQSVMLELVALTGTMVYSITNNFPFSSWGEALFLMLQTITICFLVMHYRGQTVKGVAFLACYGLVLLVLLSPLTPLTVVTLLQASNVPAVVVGRLLQAATNYHNGHTGQLSAITVFLLFGGSLARIFTSIQETGDPLMAGTFVVSSLCNGLIAAQLLFYWNAKPPHKQKKAQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1205-Ab Anti-MPDU1 monoclonal antibody
    Target Antigen GM-Tg-g-IP1205-Ag MPDU1 protein
    ORF Viral Vector pGMLP003484 Human MPDU1 Lentivirus plasmid
    ORF Viral Vector vGMLP003484 Human MPDU1 Lentivirus particle


    Target information

    Target ID GM-IP1205
    Target Name MPDU1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		9526
    Gene ID 100062007 (Equus caballus), 101098754 (Felis catus), 24070 (Mus musculus), 303244 (Rattus norvegicus)
    489477 (Canis lupus familiaris), 504961 (Bos taurus), 715962 (Macaca mulatta), 9526 (Homo sapiens)
    Gene Symbols & Synonyms MPDU1,Mpdu1,SL15,LEC35,Supl15h,CDGIF,Lec35,My008,PQLC5,PP3958,SLC66A5,HBEBP2BPA
    Target Alternative Names MPDU1,Mannose-P-dolichol utilization defect 1 protein,Suppressor of Lec15 and Lec35 glycosylation mutation homolog (SL15),SL15,CDGIF,Lec35,My008,PQLC5,PP3958,SLC66A5,HBEBP2BPA
    Uniprot Accession O75352,Q9R0Q9
    Additional SwissProt Accessions: Q9R0Q9,O75352
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSMUSG00000018761, ENSCAFG00845023654, ENSBTAG00000000134, ENSMMUG00000013503, ENSG00000129255
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.