Human TREM2/TREM-2/Trem2a ORF/cDNA clone-Lentivirus particle (NM_018965)

Cat. No.: vGMLP003467

Pre-made Human TREM2/TREM-2/Trem2a Lentiviral expression plasmid for TREM2 lentivirus packaging, TREM2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to TREM2/TREM-2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003467 Human TREM2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003467
Gene Name TREM2
Accession Number NM_018965
Gene ID 54209
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 693 bp
Gene Alias TREM-2,Trem2a,Trem2b,Trem2c
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGCCTCTCCGGCTGCTCATCTTACTCTTTGTCACAGAGCTGTCCGGAGCCCACAACACCACAGTGTTCCAGGGCGTGGCGGGCCAGTCCCTGCAGGTGTCTTGCCCCTATGACTCCATGAAGCACTGGGGGAGGCGCAAGGCCTGGTGCCGCCAGCTGGGAGAGAAGGGCCCATGCCAGCGTGTGGTCAGCACGCACAACTTGTGGCTGCTGTCCTTCCTGAGGAGGTGGAATGGGAGCACAGCCATCACAGACGATACCCTGGGTGGCACTCTCACCATTACGCTGCGGAATCTACAACCCCATGATGCGGGTCTCTACCAGTGCCAGAGCCTCCATGGCAGTGAGGCTGACACCCTCAGGAAGGTCCTGGTGGAGGTGCTGGCAGACCCCCTGGATCACCGGGATGCTGGAGATCTCTGGTTCCCCGGGGAGTCTGAGAGCTTCGAGGATGCCCATGTGGAGCACAGCATCTCCAGGAGCCTCTTGGAAGGAGAAATCCCCTTCCCACCCACTTCCATCCTTCTCCTCCTGGCCTGCATCTTTCTCATCAAGATTCTAGCAGCCAGCGCCCTCTGGGCTGCAGCCTGGCATGGACAGAAGCCAGGGACACATCCACCCAGTGAACTGGACTGTGGCCATGACCCAGGGTATCAGCTCCAAACTCTGCCAGGGCTGAGAGACACGTGA
ORF Protein Sequence MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T45086-Ab Anti-TREM2/ TREM-2/ Trem2a monoclonal antibody
    Target Antigen GM-Tg-g-T45086-Ag TREM2 VLP (virus-like particle)
    ORF Viral Vector pGMLP003467 Human TREM2 Lentivirus plasmid
    ORF Viral Vector pGMAAV000622 Human TREM2 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector vGMLP003467 Human TREM2 Lentivirus particle
    ORF Viral Vector vGMAAV000622 Human TREM2 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-T45086
    Target Name TREM2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    54209
    Gene ID 100066180 (Equus caballus), 101099297 (Felis catus), 119863908 (Canis lupus familiaris), 301227 (Rattus norvegicus)
    506467 (Bos taurus), 54209 (Homo sapiens), 719740 (Macaca mulatta), 83433 (Mus musculus)
    Gene Symbols & Synonyms TREM2,Trem2,Trem2-Mia,Trem2-Mib,AD17,PLOSL2,TREM-2,Trem2a,Trem2b,Trem2c
    Target Alternative Names AD17,PLOSL2,TREM-2,TREM2,Trem2,Trem2-Mia,Trem2-Mib,Trem2a,Trem2b,Trem2c,Triggering receptor expressed on monocytes 2,Triggering receptor expressed on myeloid cells 2
    Uniprot Accession Q99NH8,Q9NZC2
    Additional SwissProt Accessions: Q9NZC2,Q99NH8
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG Osteoclast differentiation
    Gene Ensembl ENSCAFG00845014990, ENSBTAG00000007275, ENSG00000095970, ENSMMUG00000013920, ENSMUSG00000023992
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.