Human IL17D/IL-17D ORF/cDNA clone-Lentivirus particle (NM_138284)

Cat. No.: vGMLP003442

Pre-made Human IL17D/IL-17D Lentiviral expression plasmid for IL17D lentivirus packaging, IL17D lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to IL-17D/IL17D/IL27/IL17D/IL-17D products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003442 Human IL17D Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003442
Gene Name IL17D
Accession Number NM_138284
Gene ID 53342
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 609 bp
Gene Alias IL-17D
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTGGTAGCCGGCTTCCTGCTGGCGCTGCCGCCGAGCTGGGCCGCGGGCGCCCCGAGGGCGGGCAGGCGCCCCGCGCGGCCGCGGGGCTGCGCGGACCGGCCGGAGGAGCTACTGGAGCAGCTGTACGGGCGCCTGGCGGCCGGCGTGCTCAGTGCCTTCCACCACACGCTGCAGCTGGGGCCGCGTGAGCAGGCGCGCAACGCGAGCTGCCCGGCAGGGGGCAGGCCCGCCGACCGCCGCTTCCGGCCGCCCACCAACCTGCGCAGCGTGTCGCCCTGGGCCTACAGAATCTCCTACGACCCGGCGAGGTACCCCAGGTACCTGCCTGAAGCCTACTGCCTGTGCCGGGGCTGCCTGACCGGGCTGTTCGGCGAGGAGGACGTGCGCTTCCGCAGCGCCCCTGTCTACATGCCCACCGTCGTCCTGCGCCGCACCCCCGCCTGCGCCGGCGGCCGTTCCGTCTACACCGAGGCCTACGTCACCATCCCCGTGGGCTGCACCTGCGTCCCCGAGCCGGAGAAGGACGCAGACAGCATCAACTCCAGCATCGACAAACAGGGCGCCAAGCTCCTGCTGGGCCCCAACGACGCGCCCGCTGGCCCCTGA
ORF Protein Sequence MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T41171-Ab Anti-IL17D/ IL27/ IL-17D functional antibody
    Target Antigen GM-Tg-g-T41171-Ag IL27/IL17D protein
    Cytokine cks-Tg-g-GM-T41171 interleukin 17D (IL17D) protein & antibody
    ORF Viral Vector pGMLP003442 Human IL17D Lentivirus plasmid
    ORF Viral Vector pGMLP-IL-023 Human IL17D Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-106 Human IL17D Adenovirus plasmid
    ORF Viral Vector vGMLP003442 Human IL17D Lentivirus particle
    ORF Viral Vector vGMLP-IL-023 Human IL17D Lentivirus particle
    ORF Viral Vector vGMAP-IL-106 Human IL17D Adenovirus particle


    Target information

    Target ID GM-T41171
    Target Name IL-17D/IL17D/IL27
    Gene Group Identifier
    （Target Gene ID in Homo species)         		53342
    Gene ID 101093070 (Felis catus), 102156421 (Canis lupus familiaris), 239114 (Mus musculus), 53342 (Homo sapiens)
    614982 (Bos taurus), 691799 (Rattus norvegicus), 721163 (Macaca mulatta)
    Gene Symbols & Synonyms IL17D,Il17d,IL-17D
    Target Alternative Names IL-17D, IL17D, IL27,Interleukin-17D,IL-17D,Interleukin-27 (IL-27),IL-17D
    Uniprot Accession Q8TAD2
    Additional SwissProt Accessions: Q8TAD2
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction, C-type lectin receptor signaling pathway, JAK-STAT signaling pathway, IL-17 signaling pathway
    Gene Ensembl ENSMUSG00000050222, ENSG00000172458, ENSBTAG00000060597
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.