Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human S100A9/60B8AG/CAGB ORF/cDNA clone-Lentivirus particle (NM_002965)
Cat. No.: vGMLP003387
Pre-made Human S100A9/60B8AG/CAGB Lentiviral expression plasmid for S100A9 lentivirus packaging, S100A9 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
S100A9/60B8AG products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP003387 | Human S100A9 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP003387 |
| Gene Name | S100A9 |
| Accession Number | NM_002965 |
| Gene ID | 6280 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 345 bp |
| Gene Alias | 60B8AG,CAGB,CFAG,CGLB,L1AG,LIAG,MAC387,MIF,MRP14,NIF,P14 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGACTTGCAAAATGTCGCAGCTGGAACGCAACATAGAGACCATCATCAACACCTTCCACCAATACTCTGTGAAGCTGGGGCACCCAGACACCCTGAACCAGGGGGAATTCAAAGAGCTGGTGCGAAAAGATCTGCAAAATTTTCTCAAGAAGGAGAATAAGAATGAAAAGGTCATAGAACACATCATGGAGGACCTGGACACAAATGCAGACAAGCAGCTGAGCTTCGAGGAGTTCATCATGCTGATGGCGAGGCTAACCTGGGCCTCCCACGAGAAGATGCACGAGGGTGACGAGGGCCCTGGCCACCACCATAAGCCAGGCCTCGGGGAGGGCACCCCCTAA |
| ORF Protein Sequence | MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T38431-Ab | Anti-S10A9/ S100A9/ 60B8AG monoclonal antibody |
| Target Antigen | GM-Tg-g-T38431-Ag | S100A9 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP003387 | Human S100A9 Lentivirus plasmid |
| ORF Viral Vector | pGMPC000118 | Human S100a9 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | pGMPC000398 | Human S100A9 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | pGMPC001206 | Human S100A9 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP003387 | Human S100A9 Lentivirus particle |
Target information
| Target ID | GM-T38431 |
| Target Name | S100A9 |
|
Gene Group Identifier （Target Gene ID in Homo species) |
6280 |
| Gene ID |
100061730 (Equus caballus), 101084419 (Felis catus), 20202 (Mus musculus), 490463 (Canis lupus familiaris) 532569 (Bos taurus), 6280 (Homo sapiens), 714690 (Macaca mulatta), 94195 (Rattus norvegicus) |
| Gene Symbols & Synonyms | S100A9,S100a9,p14,Cagb,GAGB,L1Ag,BEE22,MRP14,60B8Ag,MIF,NIF,P14,CAGB,CFAG,CGLB,L1AG,LIAG,60B8AG,MAC387,S100-A9,Mrp14 |
| Target Alternative Names | 60B8AG,60B8Ag,BEE22,CAGB,CFAG,CGLB,Cagb,Calgranulin-B,Calprotectin L1H subunit,GAGB,L1AG,L1Ag,LIAG,Leukocyte L1 complex heavy chain,MAC387,MIF,MRP14,Migration inhibitory factor-related protein 14 (MRP-14,Mrp14,NIF,P14,Protein S100-A9,S100 calcium-binding protein A9,S100-A9,S100A9,S100a9,p14,p14) |
| Uniprot Accession |
P06702,P28783,P31725,P50116
Additional SwissProt Accessions: P31725,P28783,P06702,P50116 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Diagnostics Biomarker |
| Disease | cancer, Glucose intolerance, Congenital occlusion of ureteropelvic junction, Gastrointestinal system cancer, Diabetic Nephropathy, Liver cell carcinoma, Perinatal necrotizing enterocolitis |
| Disease from KEGG | IL-17 signaling pathway |
| Gene Ensembl | ENSECAG00000010117, ENSMUSG00000056071, ENSCAFG00845002276, ENSBTAG00000006505, ENSG00000163220, ENSMMUG00000006868 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.