Human APOC2/APO-CII/APOC-II ORF/cDNA clone-Lentivirus particle (NM_000483)
Cat. No.: vGMLP003380
Pre-made Human APOC2/APO-CII/APOC-II Lentiviral expression plasmid for APOC2 lentivirus packaging, APOC2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
APOC2/APO-CII products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP003380 | Human APOC2 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP003380 |
Gene Name | APOC2 |
Accession Number | NM_000483 |
Gene ID | 344 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 306 bp |
Gene Alias | APO-CII,APOC-II |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGGCACACGACTCCTCCCAGCTCTGTTTCTTGTCCTCCTGGTATTGGGATTTGAGGTCCAGGGGACCCAACAGCCCCAGCAAGATGAGATGCCTAGCCCGACCTTCCTCACCCAGGTGAAGGAATCTCTCTCCAGTTACTGGGAGTCAGCAAAGACAGCCGCCCAGAACCTGTACGAGAAGACATACCTGCCCGCTGTAGATGAGAAACTCAGGGACTTGTACAGCAAAAGCACAGCAGCCATGAGCACTTACACAGGCATTTTTACTGACCAAGTTCTTTCTGTGCTGAAGGGAGAGGAGTAA |
ORF Protein Sequence | MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0673-Ab | Anti-APOC2/ APO-CII/ APOC-II functional antibody |
Target Antigen | GM-Tg-g-SE0673-Ag | APOC2 protein |
ORF Viral Vector | pGMLP003380 | Human APOC2 Lentivirus plasmid |
ORF Viral Vector | pGMLP004009 | Human APOC2 Lentivirus plasmid |
ORF Viral Vector | vGMLP003380 | Human APOC2 Lentivirus particle |
ORF Viral Vector | vGMLP004009 | Human APOC2 Lentivirus particle |
Target information
Target ID | GM-SE0673 |
Target Name | APOC2 |
Gene Group Identifier (Target Gene ID in Homo species) |
344 |
Gene ID |
100065532 (Equus caballus), 100499578 (Macaca mulatta), 101096861 (Felis catus), 11813 (Mus musculus) 292697 (Rattus norvegicus), 344 (Homo sapiens), 442969 (Canis lupus familiaris), 618039 (Bos taurus) |
Gene Symbols & Synonyms | APOC2,Apoc2,APOC4,apo-CII,apoC-II,Apo-CII,ApoC-II,RGD1560725,APO-CII,APOC-II,APOCII |
Target Alternative Names | APOC2,Apolipoprotein C-II,Apo-CII, ApoC-II,Apolipoprotein C2,APO-CII,APOC-II |
Uniprot Accession |
G3V8D4,P02655,P12278,P19034,Q05020
Additional SwissProt Accessions: Q05020,G3V8D4,P02655,P12278,P19034 |
Uniprot Entry Name | |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | |
Disease | Malignant neoplasm of bladder |
Disease from KEGG | Cholesterol metabolism |
Gene Ensembl | ENSMMUG00000055305, ENSMUSG00000002992, ENSG00000234906, ENSCAFG00845006579, ENSBTAG00000020558 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.