Human NPS/NPS ORF/cDNA clone-Lentivirus particle (NM_001030013)

Cat. No.: vGMLP003373

Pre-made Human NPS/NPS Lentiviral expression plasmid for NPS lentivirus packaging, NPS lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to NPS products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003373 Human NPS Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003373
Gene Name NPS
Accession Number NM_001030013
Gene ID 594857
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 270 bp
Gene Alias NPS
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGATTAGCTCAGTAAAACTCAATCTCATCCTAGTTCTGTCGCTGTCCACAATGCATGTGTTTTGGTGTTATCCAGTTCCATCTTCTAAGGTGTCTGGAAAATCTGATTACTTTCTCATTCTGCTGAACAGCTGCCCAACCAGATTGGACAGGAGCAAAGAACTAGCTTTTCTAAAGCCAATTTTGGAGAAGATGTTTGTGAAAAGGTCCTTTCGCAATGGAGTTGGCACAGGGATGAAAAAAACTTCCTTTCAAAGAGCAAAATCATGA
ORF Protein Sequence MISSVKLNLILVLSLSTMHVFWCYPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFLKPILEKMFVKRSFRNGVGTGMKKTSFQRAKS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1135-Ab Anti-NPS functional antibody
    Target Antigen GM-Tg-g-SE1135-Ag NPS protein
    ORF Viral Vector pGMLP003373 Human NPS Lentivirus plasmid
    ORF Viral Vector vGMLP003373 Human NPS Lentivirus particle


    Target information

    Target ID GM-SE1135
    Target Name NPS
    Gene Group Identifier
    (Target Gene ID in Homo species)
    594857
    Gene ID 100043254 (Mus musculus), 100360071 (Rattus norvegicus), 100423956 (Macaca mulatta), 104976005 (Bos taurus)
    109492896 (Felis catus), 111092983 (Canis lupus familiaris), 111769619 (Equus caballus), 594857 (Homo sapiens)
    Gene Symbols & Synonyms Nps,NPS
    Target Alternative Names NPS,Neuropeptide S
    Uniprot Accession P0C0P5,P0C0P6,P0C0P7,P0C0P8
    Additional SwissProt Accessions: P0C0P8,P0C0P7,P0C0P5,P0C0P6
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG Neuroactive ligand-receptor interaction
    Gene Ensembl ENSMUSG00000073804, ENSMMUG00000059060, ENSG00000214285
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.