Human GYPA/CD235a/GPA ORF/cDNA clone-Lentivirus particle (NM_001308190)

Cat. No.: vGMLP003338

Pre-made Human GYPA/CD235a/GPA Lentiviral expression plasmid for GYPA lentivirus packaging, GYPA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CD235a/GYPA/Glycophorin A/GYPA/CD235a products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003338 Human GYPA Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003338
Gene Name GYPA
Accession Number NM_001308190
Gene ID 2993
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 354 bp
Gene Alias CD235a,GPA,GPErik,GPSAT,HGpMiV,HGpMiXI,HGpSta(C),MN,MNS,PAS-2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTATGGAAAAATAATCTTTGTATTACTATTGTCAGATACGCACAAACGGGACACATATGCAGCCACTCCTAGAGCTCATGAAGTTTCAGAAATTTCTGTTAGAACTGTTTACCCTCCAGAAGAGGAAACCGGAGAAAGGGTACAACTTGCCCATCATTTCTCTGAACCAGAGATAACACTCATTATTTTTGGGGTGATGGCTGGTGTTATTGGAACGATCCTCTTAATTTCTTACGGTATTCGCCGACTGATAAAGAAAAGCCCATCTGATGTAAAACCTCTCCCCTCACCTGACACAGACGTGCCTTTAAGTTCTGTTGAAATAGAAAATCCAGAGACAAGTGATCAATGA
ORF Protein Sequence MYGKIIFVLLLSDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0565-Ab Anti-GLPA/ GYPA/ CD235a monoclonal antibody
    Target Antigen GM-Tg-g-MP0565-Ag GYPA VLP (virus-like particle)
    ORF Viral Vector pGMLP003338 Human GYPA Lentivirus plasmid
    ORF Viral Vector vGMLP003338 Human GYPA Lentivirus particle


    Target information

    Target ID GM-MP0565
    Target Name CD235a/GYPA/Glycophorin A
    Gene Group Identifier
    (Target Gene ID in Homo species)
    2993
    Gene ID 102150508 (Equus caballus), 109498956 (Felis catus), 2993 (Homo sapiens), 574101 (Macaca mulatta)
    617836 (Bos taurus), 688972 (Rattus norvegicus)
    Gene Symbols & Synonyms GYPA,Gypa,MN,GPA,MNS,GPSAT,PAS-2,CD235a,GPErik,HGpMiV,HGpMiXI,HGpSta(C),gpa
    Target Alternative Names CD235a,GPA,GPErik,GPSAT,GYPA,Glycophorin A,Glycophorin-A,Gypa,HGpMiV,HGpMiXI,HGpSta(C),MN,MN sialoglycoprotein,MNS,PAS-2,Sialoglycoprotein alpha,gpa
    Uniprot Accession P02724
    Additional SwissProt Accessions: P02724
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG Hematopoietic cell lineage, Malaria
    Gene Ensembl ENSECAG00000024514, ENSG00000170180, ENSMMUG00000044429, ENSBTAG00000039325
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.