Human EIF5A/EIF-5A/EIF5A1 ORF/cDNA clone-Lentivirus particle (NM_001970)
Cat. No.: vGMLP003236
Pre-made Human EIF5A/EIF-5A/EIF5A1 Lentiviral expression plasmid for EIF5A lentivirus packaging, EIF5A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
EIF5A/EIF-5A products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP003236 | Human EIF5A Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP003236 |
Gene Name | EIF5A |
Accession Number | NM_001970 |
Gene ID | 1984 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 465 bp |
Gene Alias | EIF-5A,EIF5A1,eIF5AI |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCAGATGACTTGGACTTCGAGACAGGAGATGCAGGGGCCTCAGCCACCTTCCCAATGCAGTGCTCAGCATTACGTAAGAATGGCTTTGTGGTGCTCAAAGGCCGGCCATGTAAGATCGTCGAGATGTCTACTTCGAAGACTGGCAAGCACGGCCACGCCAAGGTCCATCTGGTTGGTATTGACATCTTTACTGGGAAGAAATATGAAGATATCTGCCCGTCAACTCATAATATGGATGTCCCCAACATCAAAAGGAATGACTTCCAGCTGATTGGCATCCAGGATGGGTACCTATCACTGCTCCAGGACAGCGGGGAGGTACGAGAGGACCTTCGTCTCCCTGAGGGAGACCTTGGCAAGGAGATTGAGCAGAAGTACGACTGTGGAGAAGAGATCCTGATCACGGTGCTGTCTGCCATGACAGAGGAGGCAGCTGTTGCAATCAAGGCCATGGCAAAATAA |
ORF Protein Sequence | MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T46929-Ab | Anti-EIF5A monoclonal antibody |
Target Antigen | GM-Tg-g-T46929-Ag | EIF5A protein |
ORF Viral Vector | pGMLP003236 | Human EIF5A Lentivirus plasmid |
ORF Viral Vector | vGMLP003236 | Human EIF5A Lentivirus particle |
Target information
Target ID | GM-T46929 |
Target Name | EIF5A |
Gene Group Identifier (Target Gene ID in Homo species) |
1984 |
Gene ID |
100146743 (Equus caballus), 101095386 (Felis catus), 1984 (Homo sapiens), 276770 (Mus musculus) 287444 (Rattus norvegicus), 444990 (Bos taurus), 489468 (Canis lupus familiaris), 721812 (Macaca mulatta) |
Gene Symbols & Synonyms | EIF5A,Eif5a,FABAS,EIF-5A,EIF5A1,eIF-4D,eIF5AI,Eif4d,Eif5a1,eIF-5A,eIF-5A1,eIF-5A-1,D19Wsu54e |
Target Alternative Names | EIF5A,Eukaryotic translation initiation factor 5A-1,eIF-5A-1, eIF-5A1,Eukaryotic initiation factor 5A isoform 1 (eIF-5A), Rev-binding factor, eIF-4D,FABAS,EIF-5A,EIF5A1,eIF-4D,eIF5AI |
Uniprot Accession |
P63241,P63242,Q3T1J1,Q6EWQ7
Additional SwissProt Accessions: P63241,P63242,Q3T1J1,Q6EWQ7 |
Uniprot Entry Name | |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target |
Disease | Prostate Cancer |
Disease from KEGG | |
Gene Ensembl | ENSG00000132507, ENSMUSG00000078812, ENSBTAG00000002018, ENSCAFG00845020953, ENSMMUG00000006206 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.