Human EIF5A/EIF-5A/EIF5A1 ORF/cDNA clone-Lentivirus particle (NM_001970)

Cat. No.: vGMLP003236

Pre-made Human EIF5A/EIF-5A/EIF5A1 Lentiviral expression plasmid for EIF5A lentivirus packaging, EIF5A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to EIF5A/EIF-5A products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003236 Human EIF5A Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003236
Gene Name EIF5A
Accession Number NM_001970
Gene ID 1984
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 465 bp
Gene Alias EIF-5A,EIF5A1,eIF5AI
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAGATGACTTGGACTTCGAGACAGGAGATGCAGGGGCCTCAGCCACCTTCCCAATGCAGTGCTCAGCATTACGTAAGAATGGCTTTGTGGTGCTCAAAGGCCGGCCATGTAAGATCGTCGAGATGTCTACTTCGAAGACTGGCAAGCACGGCCACGCCAAGGTCCATCTGGTTGGTATTGACATCTTTACTGGGAAGAAATATGAAGATATCTGCCCGTCAACTCATAATATGGATGTCCCCAACATCAAAAGGAATGACTTCCAGCTGATTGGCATCCAGGATGGGTACCTATCACTGCTCCAGGACAGCGGGGAGGTACGAGAGGACCTTCGTCTCCCTGAGGGAGACCTTGGCAAGGAGATTGAGCAGAAGTACGACTGTGGAGAAGAGATCCTGATCACGGTGCTGTCTGCCATGACAGAGGAGGCAGCTGTTGCAATCAAGGCCATGGCAAAATAA
ORF Protein Sequence MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T46929-Ab Anti-EIF5A monoclonal antibody
    Target Antigen GM-Tg-g-T46929-Ag EIF5A protein
    ORF Viral Vector pGMLP003236 Human EIF5A Lentivirus plasmid
    ORF Viral Vector vGMLP003236 Human EIF5A Lentivirus particle


    Target information

    Target ID GM-T46929
    Target Name EIF5A
    Gene Group Identifier
    (Target Gene ID in Homo species)
    1984
    Gene ID 100146743 (Equus caballus), 101095386 (Felis catus), 1984 (Homo sapiens), 276770 (Mus musculus)
    287444 (Rattus norvegicus), 444990 (Bos taurus), 489468 (Canis lupus familiaris), 721812 (Macaca mulatta)
    Gene Symbols & Synonyms EIF5A,Eif5a,FABAS,EIF-5A,EIF5A1,eIF-4D,eIF5AI,Eif4d,Eif5a1,eIF-5A,eIF-5A1,eIF-5A-1,D19Wsu54e
    Target Alternative Names EIF5A,Eukaryotic translation initiation factor 5A-1,eIF-5A-1, eIF-5A1,Eukaryotic initiation factor 5A isoform 1 (eIF-5A), Rev-binding factor, eIF-4D,FABAS,EIF-5A,EIF5A1,eIF-4D,eIF5AI
    Uniprot Accession P63241,P63242,Q3T1J1,Q6EWQ7
    Additional SwissProt Accessions: P63241,P63242,Q3T1J1,Q6EWQ7
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Prostate Cancer
    Disease from KEGG
    Gene Ensembl ENSG00000132507, ENSMUSG00000078812, ENSBTAG00000002018, ENSCAFG00845020953, ENSMMUG00000006206
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.