Human CYB5A/CYB5/MCB5 ORF/cDNA clone-Lentivirus particle (NM_148923)

Cat. No.: vGMLP003025

Pre-made Human CYB5A/CYB5/MCB5 Lentiviral expression plasmid for CYB5A lentivirus packaging, CYB5A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to Cytochrome b5/CYB5A/CYB5A/CYB5 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003025 Human CYB5A Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003025
Gene Name CYB5A
Accession Number NM_148923
Gene ID 1528
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 405 bp
Gene Alias CYB5,MCB5
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAGAGCAGTCGGACGAGGCCGTGAAGTACTACACCCTAGAGGAGATTCAGAAGCACAACCACAGCAAGAGCACCTGGCTGATCCTGCACCACAAGGTGTACGATTTGACCAAATTTCTGGAAGAGCATCCTGGTGGGGAAGAAGTTTTAAGGGAACAAGCTGGAGGTGACGCTACTGAGAACTTTGAGGATGTCGGGCACTCTACAGATGCCAGGGAAATGTCCAAAACATTCATCATTGGGGAGCTCCATCCAGATGACAGACCAAAGTTAAACAAGCCTCCGGAAACTCTTATCACTACTATTGATTCTAGTTCCAGTTGGTGGACCAACTGGGTGATCCCTGCCATCTCTGCAGTGGCCGTCGCCTTGATGTATCGCCTATACATGGCAGAGGACTGA
ORF Protein Sequence MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0639-Ab Anti-CYB5A monoclonal antibody
    Target Antigen GM-Tg-g-IP0639-Ag CYB5A protein
    ORF Viral Vector pGMLP003025 Human CYB5A Lentivirus plasmid
    ORF Viral Vector vGMLP003025 Human CYB5A Lentivirus particle


    Target information

    Target ID GM-IP0639
    Target Name Cytochrome b5/CYB5A
    Gene Group Identifier
    （Target Gene ID in Homo species)         		1528
    Gene ID 100052210 (Equus caballus), 101098747 (Felis catus), 109672 (Mus musculus), 119863882 (Canis lupus familiaris)
    1528 (Homo sapiens), 281110 (Bos taurus), 64001 (Rattus norvegicus), 694723 (Macaca mulatta)
    Gene Symbols & Synonyms CYB5A,Cyb5a,CYB5,Cyb5,0610009N12Rik,MCB5,METAG
    Target Alternative Names 0610009N12Rik,CYB5,CYB5A,Cyb5,Cyb5a,Cytochrome b5,MCB5,METAG,Microsomal cytochrome b5 type A (MCB5)
    Uniprot Accession P00167,P00170,P00171,P00173,P56395
    Additional SwissProt Accessions: P00170,P56395,P00167,P00171,P00173
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSMUSG00000024646, ENSCAFG00845000926, ENSG00000166347, ENSBTAG00000012012, ENSMMUG00000013607
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.