Human NPC2/EDDM1/HE1 ORF/cDNA clone-Lentivirus particle (NM_006432)

Cat. No.: vGMLP002951

Pre-made Human NPC2/EDDM1/HE1 Lentiviral expression plasmid for NPC2 lentivirus packaging, NPC2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to NPC2/EDDM1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002951 Human NPC2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002951
Gene Name NPC2
Accession Number NM_006432
Gene ID 10577
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 456 bp
Gene Alias EDDM1,HE1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCGTTTCCTGGCAGCTACATTCCTGCTCCTGGCGCTCAGCACCGCTGCCCAGGCCGAACCGGTGCAGTTCAAGGACTGCGGTTCTGTGGATGGAGTTATAAAGGAAGTGAATGTGAGCCCATGCCCCACCCAACCCTGCCAGCTGAGCAAAGGACAGTCTTACAGCGTCAATGTCACCTTCACCAGCAATATTCAGTCTAAAAGCAGCAAGGCCGTGGTGCATGGCATCCTGATGGGCGTCCCAGTTCCCTTTCCCATTCCTGAGCCTGATGGTTGTAAGAGTGGAATTAACTGCCCTATCCAAAAAGACAAGACCTATAGCTACCTGAATAAACTACCAGTGAAAAGCGAATATCCCTCTATAAAACTGGTGGTGGAGTGGCAACTTCAGGATGACAAAAACCAAAGTCTCTTCTGCTGGGAAATCCCAGTACAGATCGTTTCTCATCTCTAA
ORF Protein Sequence MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1133-Ab Anti-NPC2/ EDDM1/ HE1 functional antibody
    Target Antigen GM-Tg-g-SE1133-Ag NPC2 protein
    ORF Viral Vector pGMLP002951 Human NPC2 Lentivirus plasmid
    ORF Viral Vector vGMLP002951 Human NPC2 Lentivirus particle


    Target information

    Target ID GM-SE1133
    Target Name NPC2
    Gene Group Identifier
    （Target Gene ID in Homo species)         		10577
    Gene ID 100051060 (Equus caballus), 101094270 (Felis catus), 10577 (Homo sapiens), 280815 (Bos taurus)
    286898 (Rattus norvegicus), 403920 (Canis lupus familiaris), 67963 (Mus musculus), 699881 (Macaca mulatta)
    Gene Symbols & Synonyms NPC2,Npc2,HE1,EDDM1,re1,CE1,2700012J19Rik
    Target Alternative Names 2700012J19Rik,CE1,EDDM1,Epididymal secretory protein E1,HE1,Human epididymis-specific protein 1 (He1),NPC intracellular cholesterol transporter 2,NPC2,Niemann-Pick disease type C2 protein,Npc2,re1
    Uniprot Accession P61916,P79345,Q28895,Q9Z0J0
    Additional SwissProt Accessions: P61916,P79345,Q28895,Q9Z0J0
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease Ovary Cancer
    Disease from KEGG Lysosome, Cholesterol metabolism
    Gene Ensembl ENSECAG00000018345, ENSG00000119655, ENSBTAG00000021955, ENSCAFG00845014286, ENSMUSG00000021242, ENSMMUG00000006563
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.