Human AVP/ADH/ARVP ORF/cDNA clone-Lentivirus particle (NM_000490)
Cat. No.: vGMLP002893
Pre-made Human AVP/ADH/ARVP Lentiviral expression plasmid for AVP lentivirus packaging, AVP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
AVP/ADH products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP002893 | Human AVP Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP002893 |
| Gene Name | AVP |
| Accession Number | NM_000490 |
| Gene ID | 551 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 495 bp |
| Gene Alias | ADH,ARVP,AVP-NPII,AVRP,VP |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCCTGACACCATGCTGCCCGCCTGCTTCCTCGGCCTACTGGCCTTCTCCTCCGCGTGCTACTTCCAGAACTGCCCGAGGGGCGGCAAGAGGGCCATGTCCGACCTGGAGCTGAGACAGTGCCTCCCCTGCGGCCCCGGGGGCAAAGGCCGCTGCTTCGGGCCCAGCATCTGCTGCGCGGACGAGCTGGGCTGCTTCGTGGGCACGGCTGAGGCGCTGCGCTGCCAGGAGGAGAACTACCTGCCGTCGCCCTGCCAGTCCGGCCAGAAGGCGTGCGGGAGCGGGGGCCGCTGCGCCGCCTTCGGCGTTTGCTGCAACGACGAGAGCTGCGTGACCGAGCCCGAGTGCCGCGAGGGCTTTCACCGCCGCGCCCGCGCCAGCGACCGGAGCAACGCCACGCAGCTGGACGGGCCGGCCGGGGCCTTGCTGCTGCGGCTGGTGCAGCTGGCCGGGGCGCCCGAGCCCTTCGAGCCCGCCCAGCCCGACGCCTACTGA |
| ORF Protein Sequence | MPDTMLPACFLGLLAFSSACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGFHRRARASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T20975-Ab | Anti-NEU2/ AVP/ ADH functional antibody |
| Target Antigen | GM-Tg-g-T20975-Ag | AVP protein |
| ORF Viral Vector | pGMLP002893 | Human AVP Lentivirus plasmid |
| ORF Viral Vector | vGMLP002893 | Human AVP Lentivirus particle |
Target information
| Target ID | GM-T20975 |
| Target Name | AVP |
|
Gene Group Identifier (Target Gene ID in Homo species) |
551 |
| Gene ID |
100066842 (Equus caballus), 101096305 (Felis catus), 11998 (Mus musculus), 24221 (Rattus norvegicus) 280728 (Bos taurus), 403579 (Canis lupus familiaris), 551 (Homo sapiens), 717101 (Macaca mulatta) |
| Gene Symbols & Synonyms | AVP,Avp,Vp,Vsp,DI,VP,ADH,Vas,AVP-NPII,ARVP,AVRP |
| Target Alternative Names | ADH,ARVP,AVP,AVP-NPII,AVRP,Avp,DI,VP,Vas,Vasopressin-neurophysin 2-copeptin,Vp,Vsp |
| Uniprot Accession |
P01180,P01182,P01185,P01186,P35455
Additional SwissProt Accessions: P01182,P35455,P01186,P01180,P01185 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target |
| Disease | |
| Disease from KEGG | Phospholipase D signaling pathway, Neuroactive ligand-receptor interaction, Vascular smooth muscle contraction |
| Gene Ensembl | ENSMUSG00000037727, ENSBTAG00000008027, ENSCAFG00845015347, ENSG00000101200, ENSMMUG00000051923 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


