Human AVP/ADH/ARVP ORF/cDNA clone-Lentivirus particle (NM_000490)

Cat. No.: vGMLP002893

Pre-made Human AVP/ADH/ARVP Lentiviral expression plasmid for AVP lentivirus packaging, AVP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to AVP/ADH products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002893 Human AVP Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002893
Gene Name AVP
Accession Number NM_000490
Gene ID 551
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 495 bp
Gene Alias ADH,ARVP,AVP-NPII,AVRP,VP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCTGACACCATGCTGCCCGCCTGCTTCCTCGGCCTACTGGCCTTCTCCTCCGCGTGCTACTTCCAGAACTGCCCGAGGGGCGGCAAGAGGGCCATGTCCGACCTGGAGCTGAGACAGTGCCTCCCCTGCGGCCCCGGGGGCAAAGGCCGCTGCTTCGGGCCCAGCATCTGCTGCGCGGACGAGCTGGGCTGCTTCGTGGGCACGGCTGAGGCGCTGCGCTGCCAGGAGGAGAACTACCTGCCGTCGCCCTGCCAGTCCGGCCAGAAGGCGTGCGGGAGCGGGGGCCGCTGCGCCGCCTTCGGCGTTTGCTGCAACGACGAGAGCTGCGTGACCGAGCCCGAGTGCCGCGAGGGCTTTCACCGCCGCGCCCGCGCCAGCGACCGGAGCAACGCCACGCAGCTGGACGGGCCGGCCGGGGCCTTGCTGCTGCGGCTGGTGCAGCTGGCCGGGGCGCCCGAGCCCTTCGAGCCCGCCCAGCCCGACGCCTACTGA
ORF Protein Sequence MPDTMLPACFLGLLAFSSACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGFHRRARASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T20975-Ab Anti-NEU2/ AVP/ ADH functional antibody
    Target Antigen GM-Tg-g-T20975-Ag AVP protein
    ORF Viral Vector pGMLP002893 Human AVP Lentivirus plasmid
    ORF Viral Vector vGMLP002893 Human AVP Lentivirus particle


    Target information

    Target ID GM-T20975
    Target Name AVP
    Gene Group Identifier
    (Target Gene ID in Homo species)
    551
    Gene ID 100066842 (Equus caballus), 101096305 (Felis catus), 11998 (Mus musculus), 24221 (Rattus norvegicus)
    280728 (Bos taurus), 403579 (Canis lupus familiaris), 551 (Homo sapiens), 717101 (Macaca mulatta)
    Gene Symbols & Synonyms AVP,Avp,Vp,Vsp,DI,VP,ADH,Vas,AVP-NPII,ARVP,AVRP
    Target Alternative Names ADH,ARVP,AVP,AVP-NPII,AVRP,Avp,DI,VP,Vas,Vasopressin-neurophysin 2-copeptin,Vp,Vsp
    Uniprot Accession P01180,P01182,P01185,P01186,P35455
    Additional SwissProt Accessions: P01182,P35455,P01186,P01180,P01185
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease
    Disease from KEGG Phospholipase D signaling pathway, Neuroactive ligand-receptor interaction, Vascular smooth muscle contraction
    Gene Ensembl ENSMUSG00000037727, ENSBTAG00000008027, ENSCAFG00845015347, ENSG00000101200, ENSMMUG00000051923
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.