Human SLURP2/SLURP-2 ORF/cDNA clone-Lentivirus particle (NM_177458)

Cat. No.: vGMLP002890

Pre-made Human SLURP2/SLURP-2 Lentiviral expression plasmid for SLURP2 lentivirus packaging, SLURP2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to SLURP2/SLURP-2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002890 Human SLURP2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002890
Gene Name SLURP2
Accession Number NM_177458
Gene ID 432355
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 294 bp
Gene Alias SLURP-2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGCTCGGCACTGGGCTCCTGCTGGCCGCCGTCCTGAGCCTGCAGCTGGCTGCAGCCGAAGCCATATGGTGTCACCAGTGCACGGGCTTCGGAGGGTGCTCCCATGGATCCAGATGCCTGAGGGACTCCACCCACTGTGTCACCACTGCCACCCGGGTCCTCAGCAACACCGAGGATTTGCCTCTGGTCACCAAGATGTGCCACATAGGCTGCCCCGATATCCCCAGCCTGGGCCTGGGCCCCTACGTATCCATCGCTTGCTGCCAGACCAGCCTCTGCAACCATGACTGA
ORF Protein Sequence MQLGTGLLLAAVLSLQLAAAEAIWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2571-Ab Anti-SLUR2/ SLURP2/ SLURP-2 monoclonal antibody
    Target Antigen GM-Tg-g-MP2571-Ag SLURP2 VLP (virus-like particle)
    ORF Viral Vector pGMLP002890 Human SLURP2 Lentivirus plasmid
    ORF Viral Vector vGMLP002890 Human SLURP2 Lentivirus particle


    Target information

    Target ID GM-MP2571
    Target Name SLURP2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    432355
    Gene ID 100428508 (Macaca mulatta), 100683842 (Canis lupus familiaris), 109496272 (Felis catus), 315074 (Rattus norvegicus)
    432355 (Homo sapiens), 69462 (Mus musculus)
    Gene Symbols & Synonyms SLURP2,Slurp2,LYNX1,RGD1308195,SLURP-2,2300005B03Rik
    Target Alternative Names 2300005B03Rik,LYNX1,RGD1308195,SLURP-2,SLURP2,Secreted LY6/PLAUR domain-containing protein 2,Secreted Ly-6/uPAR domain-containing protein 2,Secreted Ly-6/uPAR-related protein 2 (SLURP-2),Slurp2
    Uniprot Accession P0DP57,P0DP59
    Additional SwissProt Accessions: P0DP57,P0DP59
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG Neuroactive ligand-receptor interaction
    Gene Ensembl ENSMMUG00000041404, ENSG00000283992, ENSMUSG00000075605
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.