Human LEPROT/LEPR/OB-RGRP ORF/cDNA clone-Lentivirus particle (NM_001198681)

Cat. No.: vGMLP002861

Pre-made Human LEPROT/LEPR/OB-RGRP Lentiviral expression plasmid for LEPROT lentivirus packaging, LEPROT lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to LEPROT/LEPR products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002861 Human LEPROT Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002861
Gene Name LEPROT
Accession Number NM_001198681
Gene ID 54741
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 423 bp
Gene Alias LEPR,OB-RGRP,OBRGRP,VPS55
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCGAGACGGAAAAGGTTTTTTGCAAGGCTTCCTGTATTTTGCTCTCGTGGCATTATCCTTCAGTGGGGCTATTGGACTGACTTTTCTTATGCTGGGATGTGCCTTAGAGGATTATGGCGTTTACTGGCCCTTATTCGTCCTGATTTTCCACGCCATCTCCCCCATCCCCCATTTCATTGCCAAAAGAGTCACCTATGACTCAGATGCAACCAGTAGTGCCTGTCGGGAACTGGCATATTTCTTCACTACTGGAATTGTTGTTTCTGCCTTTGGATTTCCTGTTATTCTTGCTCGTGTGGCTGTGATCAAATGGGGAGCCTGCGGCCTTGTGTTGGCAGGCAATGCAGTCATTTTCCTTACAATTCAAGGGTTTTTCCTTATATTTGGAAGAGGAGATGATTTTAGCTGGGAGCAGTGGTAG
ORF Protein Sequence MRDGKGFLQGFLYFALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFHAISPIPHFIAKRVTYDSDATSSACRELAYFFTTGIVVSAFGFPVILARVAVIKWGACGLVLAGNAVIFLTIQGFFLIFGRGDDFSWEQW

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1080-Ab Anti-LEPROT monoclonal antibody
    Target Antigen GM-Tg-g-IP1080-Ag LEPROT protein
    ORF Viral Vector pGMLP002861 Human LEPROT Lentivirus plasmid
    ORF Viral Vector vGMLP002861 Human LEPROT Lentivirus particle


    Target information

    Target ID GM-IP1080
    Target Name LEPROT
    Gene Group Identifier
    （Target Gene ID in Homo species)         		54741
    Gene ID 100630509 (Equus caballus), 101085391 (Felis catus), 230514 (Mus musculus), 54741 (Homo sapiens)
    56766 (Rattus norvegicus), 609115 (Canis lupus familiaris), 613665 (Bos taurus), 703005 (Macaca mulatta)
    Gene Symbols & Synonyms LEPROT,Leprot,LEPR,VPS55,Endo1`,Obrgrp,OB-RGRP,Endospanin1,OBRGRP,Ob-Rgrp
    Target Alternative Names Endo1`,Endospanin-1,Endospanin1,LEPR,LEPROT,Leprot,Leptin receptor gene-related protein,Leptin receptor overlapping transcript protein,OB-R gene-related protein (OB-RGRP),OB-RGRP,OBRGRP,Ob-Rgrp,Obrgrp,VPS55
    Uniprot Accession O15243,O89013,Q3SYT0,Q9JLS8
    Additional SwissProt Accessions: O89013,O15243,Q9JLS8,Q3SYT0
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000016346, ENSMUSG00000035212, ENSG00000213625, ENSBTAG00000005909, ENSMMUG00000003264
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.