Human EDN3/ET-3/ET3 ORF/cDNA clone-Lentivirus particle (NM_207034)

Cat. No.: vGMLP002841

Pre-made Human EDN3/ET-3/ET3 Lentiviral expression plasmid for EDN3 lentivirus packaging, EDN3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to Endothelin 3/EDN3/EDN3/ET-3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002841 Human EDN3 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002841
Gene Name EDN3
Accession Number NM_207034
Gene ID 1908
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 717 bp
Gene Alias ET-3,ET3,HSCR4,PPET3,WS4B
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGCCGGGGCTGTGGCTCCTTTTCGGGCTCACAGTGACCTCCGCCGCAGGATTCGTGCCTTGCTCCCAGTCTGGGGATGCTGGCAGGCGCGGCGTGTCCCAGGCCCCCACTGCAGCCAGATCTGAGGGGGACTGTGAAGAGACTGTGGCTGGCCCTGGCGAGGAGACTGTGGCTGGCCCTGGCGAGGGGACTGTGGCCCCGACAGCACTGCAGGGTCCAAGCCCTGGAAGCCCTGGGCAGGAGCAGGCGGCCGAGGGGGCCCCTGAGCACCACCGATCCAGGCGCTGCACGTGCTTCACCTACAAGGACAAGGAGTGTGTCTACTATTGCCACCTGGACATCATTTGGATCAACACTCCCGAACAGACGGTGCCCTATGGACTGTCCAACTACAGAGGAAGCTTCCGGGGCAAGAGGTCTGCGGGGCCACTTCCAGGGAATCTGCAGCTCTCACATCGGCCACACTTGCGCTGCGCTTGTGTGGGGAGATATGACAAGGCCTGCCTGCACTTTTGCACCCAAACTCTGGACGTCAGCAGTAATTCAAGGACGGCAGAAAAAACAGACAAAGAAGAGGAAGGGAAGGTTGAAGTCAAGGACCAACAAAGCAAGCAGGCTTTAGACCTCCACCATCCAAAGCTCATGCCCGGCAGTGGACTCGCCCTCGCTCCATCTACCTGCCCCCGCTGCCTCTTTCAGGAAGGAGCCCCTTAG
ORF Protein Sequence MEPGLWLLFGLTVTSAAGFVPCSQSGDAGRRGVSQAPTAARSEGDCEETVAGPGEETVAGPGEGTVAPTALQGPSPGSPGQEQAAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFRGKRSAGPLPGNLQLSHRPHLRCACVGRYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVEVKDQQSKQALDLHHPKLMPGSGLALAPSTCPRCLFQEGAP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0899-Ab Anti-EDN3/ ET-3/ ET3 functional antibody
    Target Antigen GM-Tg-g-SE0899-Ag EDN3 protein
    ORF Viral Vector pGMLP002841 Human EDN3 Lentivirus plasmid
    ORF Viral Vector vGMLP002841 Human EDN3 Lentivirus particle


    Target information

    Target ID GM-SE0899
    Target Name Endothelin 3/EDN3
    Gene Group Identifier
    (Target Gene ID in Homo species)
    1908
    Gene ID 100034064 (Equus caballus), 111559745 (Felis catus), 13616 (Mus musculus), 1908 (Homo sapiens)
    366270 (Rattus norvegicus), 403406 (Canis lupus familiaris), 513753 (Bos taurus), 693385 (Macaca mulatta)
    Gene Symbols & Synonyms EDN3,Edn3,ls,ET-3,PPET3,tmgc48,ET3,WS4B,HSCR4,Et3,RGD1564825,preproET-3
    Target Alternative Names EDN3,ET-3,ET3,Edn3,Endothelin 3,Endothelin-3,Et3,HSCR4,PPET3,Preproendothelin-3 (PPET3),RGD1564825,WS4B,ls,preproET-3,tmgc48
    Uniprot Accession P13207,P14138,P48299,Q765Z4
    Additional SwissProt Accessions: P48299,P14138,P13207,Q765Z4
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG cAMP signaling pathway, Neuroactive ligand-receptor interaction, Vascular smooth muscle contraction, Renin secretion
    Gene Ensembl ENSECAG00000006225, ENSMUSG00000027524, ENSG00000124205, ENSCAFG00845014217, ENSBTAG00000012109, ENSMMUG00000016131
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.