Human LTA/LT/TNFB ORF/cDNA clone-Lentivirus particle (NM_000595)

Cat. No.: vGMLP002777

Pre-made Human LTA/LT/TNFB Lentiviral expression plasmid for LTA lentivirus packaging, LTA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to TNF Beta/TNF beta/LTA/LTA/LT products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002777 Human LTA Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002777
Gene Name LTA
Accession Number NM_000595
Gene ID 4049
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 618 bp
Gene Alias LT,TNFB,TNFSF1,TNLG1E
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACACCACCTGAACGTCTCTTCCTCCCAAGGGTGTGTGGCACCACCCTACACCTCCTCCTTCTGGGGCTGCTGCTGGTTCTGCTGCCTGGGGCCCAGGGGCTCCCTGGTGTTGGCCTCACACCTTCAGCTGCCCAGACTGCCCGTCAGCACCCCAAGATGCATCTTGCCCACAGCACCCTCAAACCTGCTGCTCACCTCATTGGAGACCCCAGCAAGCAGAACTCACTGCTCTGGAGAGCAAACACGGACCGTGCCTTCCTCCAGGATGGTTTCTCCTTGAGCAACAATTCTCTCCTGGTCCCCACCAGTGGCATCTACTTCGTCTACTCCCAGGTGGTCTTCTCTGGGAAAGCCTACTCTCCCAAGGCCACCTCCTCCCCACTCTACCTGGCCCATGAGGTCCAGCTCTTCTCCTCCCAGTACCCCTTCCATGTGCCTCTCCTCAGCTCCCAGAAGATGGTGTATCCAGGGCTGCAGGAACCCTGGCTGCACTCGATGTACCACGGGGCTGCGTTCCAGCTCACCCAGGGAGACCAGCTATCCACCCACACAGATGGCATCCCCCACCTAGTCCTCAGCCCTAGTACTGTCTTCTTTGGAGCCTTCGCTCTGTAG
ORF Protein Sequence MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-INN-749 Pre-Made Baminercept Biosimilar, Fusion Protein targeting LTA fused with human IGHG1 Fc (Fragment constant): Recombinant therapeutic protein targeting LT/TNFB/TNFSF1/TNLG1E
    Biosimilar GMP-Bios-ab-430 Pre-Made Pateclizumab biosimilar, Whole mAb, Anti-LTA Antibody: Anti-LT/TNFB/TNFSF1/TNLG1E therapeutic antibody
    Target Antibody GM-Tg-g-T85158-Ab Anti-TNFB/ LTA/ LT monoclonal antibody
    Target Antigen GM-Tg-g-T85158-Ag LTA VLP (virus-like particle)
    ORF Viral Vector pGMLP002777 Human LTA Lentivirus plasmid
    ORF Viral Vector vGMLP002777 Human LTA Lentivirus particle


    Target information

    Target ID GM-T85158
    Target Name TNF Beta/TNF beta/LTA
    Gene Group Identifier
    (Target Gene ID in Homo species)
    4049
    Gene ID 100058321 (Equus caballus), 101084961 (Felis catus), 16992 (Mus musculus), 25008 (Rattus norvegicus)
    280845 (Bos taurus), 4049 (Homo sapiens), 607183 (Canis lupus familiaris), 715425 (Macaca mulatta)
    Gene Symbols & Synonyms LTA,Lta,TNLG1E,LT,Ltx,Tnfb,LT[a],LT-[a],TNFSF1,Tnlg1e,hlb382,LTalpha,Tnfsf1b,LT-alpha,TNF-beta,TNFB
    Target Alternative Names LT,LT-[a],LT-alpha,LTA,LT[a],LTalpha,Lta,Ltx,Lymphotoxin-alpha,TNF Beta,TNF beta,TNF-beta,TNFB,TNFSF1,TNLG1E,Tnfb,Tnfsf1b,Tnlg1e,Tumor necrosis factor ligand superfamily member 1,hlb382
    Uniprot Accession P01374,P09225,Q06332,Q06600,Q5TM20,Q5WR07
    Additional SwissProt Accessions: P09225,Q06332,Q06600,P01374,Q5WR07,Q5TM20
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, INN Index
    Disease cancer
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, NF-kappa B signaling pathway, TNF signaling pathway, Type I diabetes mellitus, Human T-cell leukemia virus 1 infection
    Gene Ensembl ENSMUSG00000024402, ENSBTAG00000000016, ENSG00000226979, ENSCAFG00845010521, ENSMMUG00000008843
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.