Human KLK7/hK7/PRSS6 ORF/cDNA clone-Lentivirus particle (NM_005046)

Cat. No.: vGMLP002775

Pre-made Human KLK7/hK7/PRSS6 Lentiviral expression plasmid for KLK7 lentivirus packaging, KLK7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to KLK7/hK7 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002775 Human KLK7 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002775
Gene Name KLK7
Accession Number NM_005046
Gene ID 5650
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 762 bp
Gene Alias hK7,PRSS6,SCCE
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAAGATCCCTTCTCCTGCCCCTGCAGATCTTACTGCTATCCTTAGCCTTGGAAACTGCAGGAGAAGAAGCCCAGGGTGACAAGATTATTGATGGCGCCCCATGTGCAAGAGGCTCCCACCCATGGCAGGTGGCCCTGCTCAGTGGCAATCAGCTCCACTGCGGAGGCGTCCTGGTCAATGAGCGCTGGGTGCTCACTGCCGCCCACTGCAAGATGAATGAGTACACCGTGCACCTGGGCAGTGATACGCTGGGCGACAGGAGAGCTCAGAGGATCAAGGCCTCGAAGTCATTCCGCCACCCCGGCTACTCCACACAGACCCATGTTAATGACCTCATGCTCGTGAAGCTCAATAGCCAGGCCAGGCTGTCATCCATGGTGAAGAAAGTCAGGCTGCCCTCCCGCTGCGAACCCCCTGGAACCACCTGTACTGTCTCCGGCTGGGGCACTACCACGAGCCCAGATGTGACCTTTCCCTCTGACCTCATGTGCGTGGATGTCAAGCTCATCTCCCCCCAGGACTGCACGAAGGTTTACAAGGACTTACTGGAAAATTCCATGCTGTGCGCTGGCATCCCCGACTCCAAGAAAAACGCCTGCAATGGTGACTCAGGGGGACCGTTGGTGTGCAGAGGTACCCTGCAAGGTCTGGTGTCCTGGGGAACTTTCCCTTGCGGCCAACCCAATGACCCAGGAGTCTACACTCAAGTGTGCAAGTTCACCAAGTGGATAAATGACACCATGAAAAAGCATCGCTAA
ORF Protein Sequence MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T79155-Ab Anti-KLK7/ PRSS6/ SCCE functional antibody
    Target Antigen GM-Tg-g-T79155-Ag KLK7 protein
    ORF Viral Vector pGMLP002775 Human KLK7 Lentivirus plasmid
    ORF Viral Vector pGMLP004027 Human KLK7 Lentivirus plasmid
    ORF Viral Vector vGMLP002775 Human KLK7 Lentivirus particle
    ORF Viral Vector vGMLP004027 Human KLK7 Lentivirus particle


    Target information

    Target ID GM-T79155
    Target Name KLK7
    Gene Group Identifier
    (Target Gene ID in Homo species)
    5650
    Gene ID 100146194 (Equus caballus), 101088894 (Felis catus), 23993 (Mus musculus), 292852 (Rattus norvegicus)
    506380 (Bos taurus), 5650 (Homo sapiens), 611780 (Canis lupus familiaris), 722683 (Macaca mulatta)
    Gene Symbols & Synonyms KLK7,Klk7,SCCE,Prss6,KLND,hK7,PRSS6
    Target Alternative Names KLK7,KLND,Kallikrein-7,Klk7,PRSS6,Prss6,SCCE,Serine protease 6,Stratum corneum chymotryptic enzyme (hSCCE),hK7
    Uniprot Accession P49862,Q91VE3
    Additional SwissProt Accessions: Q91VE3,P49862
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Lung Cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000031882, ENSMUSG00000030713, ENSBTAG00000030483, ENSG00000169035, ENSCAFG00845015235
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.