Human IL17F/CANDF6/IL-17F ORF/cDNA clone-Lentivirus particle (NM_052872)

Cat. No.: vGMLP002770

Pre-made Human IL17F/CANDF6/IL-17F Lentiviral expression plasmid for IL17F lentivirus packaging, IL17F lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to IL-17F/IL17F/IL17F/CANDF6 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002770 Human IL17F Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002770
Gene Name IL17F
Accession Number NM_052872
Gene ID 112744
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 492 bp
Gene Alias CANDF6,IL-17F,ML-1,ML1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACAGTGAAGACCCTGCATGGCCCAGCCATGGTCAAGTACTTGCTGCTGTCGATATTGGGGCTTGCCTTTCTGAGTGAGGCGGCAGCTCGGAAAATCCCCAAAGTAGGACATACTTTTTTCCAAAAGCCTGAGAGTTGCCCGCCTGTGCCAGGAGGTAGTATGAAGCTTGACATTGGCATCATCAATGAAAACCAGCGCGTTTCCATGTCACGTAACATCGAGAGCCGCTCCACCTCCCCCTGGAATTACACTGTCACTTGGGACCCCAACCGGTACCCCTCGGAAGTTGTACAGGCCCAGTGTAGGAACTTGGGCTGCATCAATGCTCAAGGAAAGGAAGACATCTCCATGAATTCCGTTCCCATCCAGCAAGAGACCCTGGTCGTCCGGAGGAAGCACCAAGGCTGCTCTGTTTCTTTCCAGTTGGAGAAGGTGCTGGTGACTGTTGGCTGCACCTGCGTCACCCCTGTCATCCACCATGTGCAGTAA
ORF Protein Sequence MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-INN-996 Pre-Made Sonelokimab Biosimilar, Bispecific, Anti-ALB;IL17A/IL17;IL17F Antibody: Anti-FDAHT/HSA/PRO0883/PRO0903/PRO1341;CTLA-8/CTLA8/IL-17A/ILA17;CANDF6/ML-1/ML1 therapeutic antibody
    Target Antibody GM-Tg-g-T06542-Ab Anti-IL17F/ CANDF6/ IL-17F functional antibody
    Target Antigen GM-Tg-g-T06542-Ag IL17F protein
    Cytokine cks-Tg-g-GM-T06542 Interleukin 17F (IL17F) protein & antibody
    ORF Viral Vector pGMLP002770 Human IL17F Lentivirus plasmid
    ORF Viral Vector pGMLP-IL-024 Human IL17F Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-107 Human IL17F Adenovirus plasmid
    ORF Viral Vector vGMLP002770 Human IL17F Lentivirus particle
    ORF Viral Vector vGMLP-IL-024 Human IL17F Lentivirus particle
    ORF Viral Vector vGMAP-IL-107 Human IL17F Adenovirus particle


    Target information

    Target ID GM-T06542
    Target Name IL-17F/IL17F
    Gene Group Identifier
    (Target Gene ID in Homo species)
    112744
    Gene ID 100069094 (Equus caballus), 101095826 (Felis catus), 112744 (Homo sapiens), 257630 (Mus musculus)
    301291 (Rattus norvegicus), 481838 (Canis lupus familiaris), 506030 (Bos taurus), 708220 (Macaca mulatta)
    Gene Symbols & Synonyms IL17F,Il17f,ML1,ML-1,IL17A,CANDF6,IL-17F
    Target Alternative Names IL-17F, IL17F,Interleukin-17F,IL-17F,Cytokine ML-1,ML1,ML-1,IL17A,CANDF6,IL-17F
    Uniprot Accession Q5BJ95,Q7TNI7,Q96PD4
    Additional SwissProt Accessions: Q96PD4,Q7TNI7,Q5BJ95
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, INN Index, Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction, IL-17 signaling pathway, Th17 cell differentiation, Inflammatory bowel disease
    Gene Ensembl ENSECAG00000031935, ENSG00000112116, ENSMUSG00000041872, ENSBTAG00000016835, ENSMMUG00000006691
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.