Human CXCL9/CMK/crg-10 ORF/cDNA clone-Lentivirus particle (NM_002416)

Cat. No.: vGMLP002749

Pre-made Human CXCL9/CMK/crg-10 Lentiviral expression plasmid for CXCL9 lentivirus packaging, CXCL9 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CXCL9/MIG/CXCL9/CMK products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002749 Human CXCL9 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002749
Gene Name CXCL9
Accession Number NM_002416
Gene ID 4283
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 378 bp
Gene Alias CMK,crg-10,Humig,MIG,SCYB9
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGAAAAGTGGTGTTCTTTTCCTCTTGGGCATCATCTTGCTGGTTCTGATTGGAGTGCAAGGAACCCCAGTAGTGAGAAAGGGTCGCTGTTCCTGCATCAGCACCAACCAAGGGACTATCCACCTACAATCCTTGAAAGACCTTAAACAATTTGCCCCAAGCCCTTCCTGCGAGAAAATTGAAATCATTGCTACACTGAAGAATGGAGTTCAAACATGTCTAAACCCAGATTCAGCAGATGTGAAGGAACTGATTAAAAAGTGGGAGAAACAGGTCAGCCAAAAGAAAAAGCAAAAGAATGGGAAAAAACATCAAAAAAAGAAAGTTCTGAAAGTTCGAAAATCTCAACGTTCTCGTCAAAAGAAGACTACATAA
ORF Protein Sequence MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T56349-Ab Anti-CXCL9/ CMK/ Humig functional antibody
    Target Antigen GM-Tg-g-T56349-Ag CXCL9 protein
    Cytokine cks-Tg-g-GM-T56349 chemokine (C-X-C motif) ligand 9 (CXCL9) protein & antibody
    ORF Viral Vector pGMLP002749 Human CXCL9 Lentivirus plasmid
    ORF Viral Vector pGMPC001262 Human CXCL9 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP002749 Human CXCL9 Lentivirus particle


    Target information

    Target ID GM-T56349
    Target Name CXCL9/MIG
    Gene Group Identifier
    （Target Gene ID in Homo species)         		4283
    Gene ID 100057927 (Equus caballus), 101100388 (Felis catus), 17329 (Mus musculus), 246759 (Rattus norvegicus)
    4283 (Homo sapiens), 513990 (Bos taurus), 574336 (Macaca mulatta)
    Gene Symbols & Synonyms CXCL9,Cxcl9,CMK,Mig,MuMIG,Scyb9,crg-10,MIG,Humig,SCYB9
    Target Alternative Names C-X-C motif chemokine 9,CMK,CXCL9,Cxcl9,Gamma-interferon-induced monokine,Humig,MIG,MIG),Mig,Monokine induced by interferon-gamma (HuMIG,MuMIG,SCYB9,Scyb9,Small-inducible cytokine B9,crg-10
    Uniprot Accession A9QWP9,P18340,Q07325
    Additional SwissProt Accessions: P18340,Q07325,A9QWP9
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Immuno-oncology Target, Cytokine Target
    Disease cancer, Hyperacute Allograft Rejection, Complications of kidney transplant, Kidney transplant rejection
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, Toll-like receptor signaling pathway
    Gene Ensembl ENSECAG00000046132, ENSMUSG00000029417, ENSG00000138755, ENSBTAG00000069240
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.