Human CXCL3/CINC-2b/GRO3 ORF/cDNA clone-Lentivirus particle (NM_002090)
Cat. No.: vGMLP002748
Pre-made Human CXCL3/CINC-2b/GRO3 Lentiviral expression plasmid for CXCL3 lentivirus packaging, CXCL3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
CXCL3/GRO Gamma/CXCL3/CINC-2b products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP002748 | Human CXCL3 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP002748 |
| Gene Name | CXCL3 |
| Accession Number | NM_002090 |
| Gene ID | 2921 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 324 bp |
| Gene Alias | CINC-2b,GRO3,GROg,MIP-2b,MIP2B,SCYB3 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCCCACGCCACGCTCTCCGCCGCCCCCAGCAATCCCCGGCTCCTGCGGGTGGCGCTGCTGCTCCTGCTCCTGGTGGCCGCCAGCCGGCGCGCAGCAGGAGCGTCCGTGGTCACTGAACTGCGCTGCCAGTGCTTGCAGACACTGCAGGGAATTCACCTCAAGAACATCCAAAGTGTGAATGTAAGGTCCCCCGGACCCCACTGCGCCCAAACCGAAGTCATAGCCACACTCAAGAATGGGAAGAAAGCTTGTCTCAACCCCGCATCCCCCATGGTTCAGAAAATCATCGAAAAGATACTGAACAAGGGGAGCACCAACTGA |
| ORF Protein Sequence | MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE0843-Ab | Anti-CXCL3/ CINC-2b/ GRO3 functional antibody |
| Target Antigen | GM-Tg-g-SE0843-Ag | CXCL3 protein |
| Cytokine | cks-Tg-g-GM-SE0843 | chemokine (C-X-C motif) ligand 3 (CXCL3) protein & antibody |
| ORF Viral Vector | pGMLP002748 | Human CXCL3 Lentivirus plasmid |
| ORF Viral Vector | vGMLP002748 | Human CXCL3 Lentivirus particle |
Target information
| Target ID | GM-SE0843 |
| Target Name | CXCL3/GRO Gamma |
|
Gene Group Identifier (Target Gene ID in Homo species) |
2921 |
| Gene ID | 2921 (Homo sapiens) |
| Gene Symbols & Synonyms | CXCL3,GRO3,GROg,MIP2B,SCYB3,MIP-2b,CINC-2b |
| Target Alternative Names | C-X-C motif chemokine 3,CINC-2b,CXCL3,GRO Gamma,GRO-gamma(1-73),GRO3,GROg,Growth-regulated protein gamma (GRO-gamma),MIP-2b,MIP2B,Macrophage inflammatory protein 2-beta (MIP2-beta),SCYB3 |
| Uniprot Accession |
P19876
Additional SwissProt Accessions: P19876 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Cytokine Target |
| Disease | cancer |
| Disease from KEGG | Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, NF-kappa B signaling pathway, NOD-like receptor signaling pathway, IL-17 signaling pathway, TNF signaling pathway, Alcoholic liver disease, Epithelial cell signaling in Helicobacter pylori infection, Legionellosis, Amoebiasis, Kaposi sarcoma-associated herpesvirus infection, Rheumatoid arthritis, Lipid and atherosclerosis |
| Gene Ensembl | ENSG00000163734 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


