Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human BIRC7/KIAP/LIVIN ORF/cDNA clone-Lentivirus particle (NM_022161)
Cat. No.: vGMLP002724
Pre-made Human BIRC7/KIAP/LIVIN Lentiviral expression plasmid for BIRC7 lentivirus packaging, BIRC7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
Livin/BIRC7/ML-IAP/BIRC7/KIAP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP002724 | Human BIRC7 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP002724 |
| Gene Name | BIRC7 |
| Accession Number | NM_022161 |
| Gene ID | 79444 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 843 bp |
| Gene Alias | KIAP,LIVIN,ML-IAP,MLIAP,RNF50 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGGACCTAAAGACAGTGCCAAGTGCCTGCACCGTGGACCACAGCCGAGCCACTGGGCAGCCGGTGATGGTCCCACGCAGGAGCGCTGTGGACCCCGCTCTCTGGGCAGCCCTGTCCTAGGCCTGGACACCTGCAGAGCCTGGGACCACGTGGATGGGCAGATCCTGGGCCAGCTGCGGCCCCTGACAGAGGAGGAAGAGGAGGAGGGCGCCGGGGCCACCTTGTCCAGGGGGCCTGCCTTCCCCGGCATGGGCTCTGAGGAGTTGCGTCTGGCCTCCTTCTATGACTGGCCGCTGACTGCTGAGGTGCCACCCGAGCTGCTGGCTGCTGCCGGCTTCTTCCACACAGGCCATCAGGACAAGGTGAGGTGCTTCTTCTGCTATGGGGGCCTGCAGAGCTGGAAGCGCGGGGACGACCCCTGGACGGAGCATGCCAAGTGGTTCCCCAGCTGTCAGTTCCTGCTCCGGTCAAAAGGAAGAGACTTTGTCCACAGTGTGCAGGAGACTCACTCCCAGCTGCTGGGCTCCTGGGACCCGTGGGAAGAACCGGAAGACGCAGCCCCTGTGGCCCCCTCCGTCCCTGCCTCTGGGTACCCTGAGCTGCCCACACCCAGGAGAGAGGTCCAGTCTGAAAGTGCCCAGGAGCCAGGAGCCAGGGATGTGGAGGCGCAGCTGCGGCGGCTGCAGGAGGAGAGGACGTGCAAGGTGTGCCTGGACCGCGCCGTGTCCATCGTCTTTGTGCCGTGCGGCCACCTGGTCTGTGCTGAGTGTGCCCCCGGCCTGCAGCTGTGCCCCATCTGCAGAGCCCCCGTCCGCAGCCGCGTGCGCACCTTCCTGTCCTAG |
| ORF Protein Sequence | MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T42247-Ab | Anti-ML-IAP monoclonal antibody |
| Target Antigen | GM-Tg-g-T42247-Ag | ML-IAP/BIRC7 protein |
| ORF Viral Vector | pGMLP002724 | Human BIRC7 Lentivirus plasmid |
| ORF Viral Vector | pGMPC000540 | Human BIRC7 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP002724 | Human BIRC7 Lentivirus particle |
Target information
| Target ID | GM-T42247 |
| Target Name | Livin/BIRC7/ML-IAP |
|
Gene Group Identifier （Target Gene ID in Homo species) |
79444 |
| Gene ID |
100147373 (Equus caballus), 101080371 (Felis catus), 296468 (Rattus norvegicus), 329581 (Mus musculus) 485969 (Canis lupus familiaris), 514508 (Bos taurus), 697671 (Macaca mulatta), 79444 (Homo sapiens) |
| Gene Symbols & Synonyms | BIRC7,Birc7,RGD1562883,KIAP,Livin,ML-IAP,E130019N06,LIVIN,MLIAP,RNF50 |
| Target Alternative Names | Livin, BIRC7, ML-IAP,Baculoviral IAP repeat-containing protein 7,Kidney inhibitor of apoptosis protein (KIAP), Livin, Melanoma inhibitor of apoptosis protein (ML-IAP), RING finger protein 50, RING-type E3 ubiquitin transferase BIRC7,KIAP,LIVIN,MLIAP,RNF50,ML-IAP |
| Uniprot Accession |
A2AWP0,Q96CA5
Additional SwissProt Accessions: A2AWP0,Q96CA5 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | cancer |
| Disease from KEGG | Apoptosis - multiple species, Toxoplasmosis, Pathways in cancer, Small cell lung cancer |
| Gene Ensembl | ENSECAG00000020286, ENSMUSG00000038840, ENSBTAG00000004911, ENSMMUG00000009229, ENSG00000101197 |
| Target Classification | Tumor-associated antigen (TAA) |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.