Human LAMA4/CMD1JJ/LAMA3 ORF/cDNA clone-Lentivirus particle (NM_001105209)

Cat. No.: vGMLP002644

Pre-made Human LAMA4/CMD1JJ/LAMA3 Lentiviral expression plasmid for LAMA4 lentivirus packaging, LAMA4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to LAMA4/Laminin alpha 4/LAMA4/CMD1JJ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002644 Human LAMA4 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002644
Gene Name LAMA4
Accession Number NM_001105209
Gene ID 3910
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 363 bp
Gene Alias CMD1JJ,LAMA3,LAMA4*-1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTTTGAGCTCAGCCTGGCGCTCGGTTCTGCCTCTGTGGCTCCTCTGGAGCGCTGCCTGCTCCCGCGCCGCGTCCGGGGACGACAACGCTTTTCCTTTTGACATTGAAGGGAGCTCAGCGGTTGGCAGGCAAGACCCGCCTGAGACGAGCGAACCCCGCGTGGCTCTGGGACGCCTGCCGCCTGCGGCCGAGGTACAGTGTCCCTGCCATTGCCACCCTGCTGGGGCACCTGCGCCCCCGCGGGCTGTGCCACACTCGTCCTTCTCTCTCTCTCCGCCTCTTTCCTCTCCCCAGTGCCTTGAGAGTTTCACCTGGGCTAGGTCAGTTCGGAAACTTGAAATAAAGAGTTTTCCTTTGTAA
ORF Protein Sequence MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRLPPAAEVQCPCHCHPAGAPAPPRAVPHSSFSLSPPLSSPQCLESFTWARSVRKLEIKSFPL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0298-Ab Anti-LAMA4/ CMD1JJ/ LAMA3*-1 functional antibody
    Target Antigen GM-Tg-g-SE0298-Ag LAMA4 protein
    ORF Viral Vector pGMLP002644 Human LAMA4 Lentivirus plasmid
    ORF Viral Vector vGMLP002644 Human LAMA4 Lentivirus particle


    Target information

    Target ID GM-SE0298
    Target Name LAMA4/Laminin alpha 4
    Gene Group Identifier
    （Target Gene ID in Homo species)         		3910
    Gene ID 100066875 (Equus caballus), 101086907 (Felis catus), 16775 (Mus musculus), 309816 (Rattus norvegicus)
    3910 (Homo sapiens), 475034 (Canis lupus familiaris), 529670 (Bos taurus), 696685 (Macaca mulatta)
    Gene Symbols & Synonyms LAMA4,Lama4,RGD1560062,LAMA3,CMD1JJ,LAMA4*-1
    Target Alternative Names CMD1JJ,LAMA3,LAMA4,LAMA4*-1,Lama4,Laminin alpha 4,Laminin subunit alpha-4,Laminin-14 subunit alpha,Laminin-8 subunit alpha,Laminin-9 subunit alpha,RGD1560062
    Uniprot Accession P97927,Q16363
    Additional SwissProt Accessions: P97927,Q16363
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG PI3K-Akt signaling pathway, Focal adhesion, ECM-receptor interaction, African trypanosomiasis, Toxoplasmosis, Amoebiasis, Human papillomavirus infection, Pathways in cancer, Small cell lung cancer
    Gene Ensembl ENSECAG00000018584, ENSMUSG00000019846, ENSG00000112769, ENSCAFG00845018962, ENSBTAG00000008817, ENSMMUG00000013782
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.