Human CD160/BY55/NK1 ORF/cDNA clone-Lentivirus particle (NM_007053)
Cat. No.: vGMLP002493
Pre-made Human CD160/BY55/NK1 Lentiviral expression plasmid for CD160 lentivirus packaging, CD160 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
CD160/BY55 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP002493 | Human CD160 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP002493 |
| Gene Name | CD160 |
| Accession Number | NM_007053 |
| Gene ID | 11126 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 546 bp |
| Gene Alias | BY55,NK1,NK28 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCTGTTGGAACCCGGCAGAGGCTGCTGTGCCCTGGCCATCCTGCTGGCAATTGTGGACATCCAGTCTGGTGGATGCATTAACATCACCAGCTCAGCTTCCCAGGAAGGAACGCGACTAAACTTAATCTGTACTGTATGGCATAAGAAAGAAGAGGCTGAGGGGTTTGTAGTGTTTTTGTGCAAGGACAGGTCTGGAGACTGTTCTCCTGAGACCAGTTTAAAACAGCTGAGACTTAAAAGGGATCCTGGGATAGATGGTGTTGGTGAAATATCATCTCAGTTGATGTTCACCATAAGCCAAGTCACACCGTTGCACAGTGGGACCTACCAGTGTTGTGCCAGAAGCCAGAAGTCAGGTATCCGCCTTCAGGGCCATTTTTTCTCCATTCTATTCACAGAGACAGGGAACTACACAGTGACGGGATTGAAACAAAGACAACACCTTGAGTTCAGCCATAATGAAGGCACTCTCAGTTCAGGCTTCCTACAAGAAAAGGTCTGGGTAATGCTGGTCACCAGCCTTGTGGCCCTTCAAGCTTTGTAA |
| ORF Protein Sequence | MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQAL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T57907-Ab | Anti-BY55/ CD160/ NK1 monoclonal antibody |
| Target Antigen | GM-Tg-g-T57907-Ag | CD160 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP002493 | Human CD160 Lentivirus plasmid |
| ORF Viral Vector | vGMLP002493 | Human CD160 Lentivirus particle |
Target information
| Target ID | GM-T57907 |
| Target Name | CD160 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
11126 |
| Gene ID |
100065657 (Equus caballus), 100125861 (Felis catus), 104971522 (Bos taurus), 11126 (Homo sapiens) 483158 (Canis lupus familiaris), 502585 (Rattus norvegicus), 54215 (Mus musculus), 696832 (Macaca mulatta) |
| Gene Symbols & Synonyms | CD160,Cd160,BY55,NK1,NK28,RGD1563598,By55 |
| Target Alternative Names | BY55,By55,CD160,CD160 antigen,Cd160,NK1,NK28,Natural killer cell receptor BY55,RGD1563598 |
| Uniprot Accession |
O88875,O95971
Additional SwissProt Accessions: O95971,O88875 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Immuno-oncology Target |
| Disease | |
| Disease from KEGG | |
| Gene Ensembl | ENSECAG00000010888, ENSG00000117281, ENSCAFG00845010227, ENSMUSG00000038304, ENSMMUG00000007969 |
| Target Classification | Checkpoint-Immuno Oncology |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


