Human MLN ORF/cDNA clone-Lentivirus particle (NM_002418)

Cat. No.: vGMLP002406

Pre-made Human MLN/ Lentiviral expression plasmid for MLN lentivirus packaging, MLN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to MLN products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002406 Human MLN Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002406
Gene Name MLN
Accession Number NM_002418
Gene ID 4295
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 348 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTATCCCGTAAGGCTGTGGCTGCTCTGCTGGTGGTGCATGTAGCTGCCATGCTGGCCTCCCAGACGGAAGCCTTCGTCCCCATCTTCACCTATGGCGAACTCCAGAGGATGCAGGAAAAGGAACGGAATAAAGGGCAAAAGAAATCCCTGAGTGTATGGCAGAGGTCTGGGGAGGAAGGTCCTGTAGACCCTGCGGAGCCCATCAGGGAAGAAGAAAACGAAATGATCAAGCTGACTGCTCCTCTGGAAATTGGAATGAGGATGAACTCCAGACAGCTGGAAAAGTACCCGGCCACCCTGGAAGGGCTGCTGAGTGAGATGCTTCCCCAGCATGCAGCCAAGTGA
ORF Protein Sequence MVSRKAVAALLVVHVAAMLASQTEAFVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0351-Ab Anti-MOTI/ MLN functional antibody
    Target Antigen GM-Tg-g-SE0351-Ag MLN protein
    ORF Viral Vector pGMLP002406 Human MLN Lentivirus plasmid
    ORF Viral Vector vGMLP002406 Human MLN Lentivirus particle


    Target information

    Target ID GM-SE0351
    Target Name MLN
    Gene Group Identifier
    （Target Gene ID in Homo species)         		4295
    Gene ID 100033882 (Equus caballus), 100126231 (Rattus norvegicus), 280860 (Bos taurus), 4295 (Homo sapiens)
    481748 (Canis lupus familiaris), 493834 (Felis catus), 574099 (Macaca mulatta)
    Gene Symbols & Synonyms MLN,Mln
    Target Alternative Names MLN,Mln,Promotilin
    Uniprot Accession O18811,O46617,O62820,P12872,P19863,Q9XSE2
    Additional SwissProt Accessions: O46617,O62820,P12872,P19863,Q9XSE2,O18811
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG Neuroactive ligand-receptor interaction
    Gene Ensembl ENSECAG00000014006, ENSBTAG00000015550, ENSG00000096395, ENSCAFG00845026089, ENSMMUG00000021738
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.