Human MAL2 ORF/cDNA clone-Lentivirus particle (NM_052886)

Cat. No.: vGMLP002369

Pre-made Human MAL2/ Lentiviral expression plasmid for MAL2 lentivirus packaging, MAL2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to MAL2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002369 Human MAL2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002369
Gene Name MAL2
Accession Number NM_052886
Gene ID 114569
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 531 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCGGCCGGCGGAGCGTCAGTCCCGCCGCCCCCGAACCCCGCCGTGTCCTTCCCGCCGCCCCGGGTCACCCTGCCCGCCGGCCCCGACATCCTGCGGACCTACTCGGGCGCCTTCGTCTGCCTGGAGATTCTGTTCGGGGGTCTTGTCTGGATTTTGGTTGCCTCCTCCAATGTTCCTCTACCTCTACTACAAGGATGGGTCATGTTTGTGTCCGTGACAGCGTTTTTCTTTTCGCTCCTCTTTCTGGGCATGTTCCTCTCTGGCATGGTGGCTCAAATTGATGCTAACTGGAACTTCCTGGATTTTGCCTACCATTTTACAGTATTTGTCTTCTATTTTGGAGCCTTTTTATTGGAAGCAGCAGCCACATCCCTGCATGATTTGCATTGCAATACAACCATAACCGGGCAGCCACTCCTGAGTGATAACCAGTATAACATAAACGTAGCAGCCTCAATTTTTGCCTTTATGACGACAGCTTGTTATGGTTGCAGTTTGGGTCTGGCTTTACGAAGATGGCGACCGTAA
ORF Protein Sequence MSAGGASVPPPPNPAVSFPPPRVTLPAGPDILRTYSGAFVCLEILFGGLVWILVASSNVPLPLLQGWVMFVSVTAFFFSLLFLGMFLSGMVAQIDANWNFLDFAYHFTVFVFYFGAFLLEAAATSLHDLHCNTTITGQPLLSDNQYNINVAASIFAFMTTACYGCSLGLALRRWRP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1137-Ab Anti-MAL2 monoclonal antibody
    Target Antigen GM-Tg-g-IP1137-Ag MAL2 protein
    ORF Viral Vector pGMLP002369 Human MAL2 Lentivirus plasmid
    ORF Viral Vector vGMLP002369 Human MAL2 Lentivirus particle


    Target information

    Target ID GM-IP1137
    Target Name MAL2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    114569
    Gene ID 100066039 (Equus caballus), 101081865 (Felis catus), 105853 (Mus musculus), 114569 (Homo sapiens)
    362911 (Rattus norvegicus), 511940 (Bos taurus), 608995 (Canis lupus familiaris), 705045 (Macaca mulatta)
    Gene Symbols & Synonyms MAL2,Mal2
    Target Alternative Names MAL2,Protein MAL2
    Uniprot Accession A2VE13,Q8BI08,Q969L2
    Additional SwissProt Accessions: Q8BI08,Q969L2,A2VE13
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000022537, ENSMUSG00000024479, ENSG00000147676, ENSBTAG00000011779, ENSCAFG00845005680, ENSMMUG00000004296
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.