Human FCGRT/alpha-chain/FCRN ORF/cDNA clone-Lentivirus particle (NM_004107)

Cat. No.: vGMLP002368

Pre-made Human FCGRT/alpha-chain/FCRN Lentiviral expression plasmid for FCGRT lentivirus packaging, FCGRT lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to FcRn/FCGRT/FCGRT/alpha-chain products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002368 Human FCGRT Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002368
Gene Name FCGRT
Accession Number NM_004107
Gene ID 2217
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 1098 bp
Gene Alias alpha-chain,FCRN
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGGTCCCGCGGCCTCAGCCCTGGGCGCTGGGGCTCCTGCTCTTTCTCCTTCCTGGGAGCCTGGGCGCAGAAAGCCACCTCTCCCTCCTGTACCACCTTACCGCGGTGTCCTCGCCTGCCCCGGGGACTCCTGCCTTCTGGGTGTCCGGCTGGCTGGGCCCGCAGCAGTACCTGAGCTACAATAGCCTGCGGGGCGAGGCGGAGCCCTGTGGAGCTTGGGTCTGGGAAAACCAGGTGTCCTGGTATTGGGAGAAAGAGACCACAGATCTGAGGATCAAGGAGAAGCTCTTTCTGGAAGCTTTCAAAGCTTTGGGGGGAAAAGGTCCCTACACTCTGCAGGGCCTGCTGGGCTGTGAACTGGGCCCTGACAACACCTCGGTGCCCACCGCCAAGTTCGCCCTGAACGGCGAGGAGTTCATGAATTTCGACCTCAAGCAGGGCACCTGGGGTGGGGACTGGCCCGAGGCCCTGGCTATCAGTCAGCGGTGGCAGCAGCAGGACAAGGCGGCCAACAAGGAGCTCACCTTCCTGCTATTCTCCTGCCCGCACCGCCTGCGGGAGCACCTGGAGAGGGGCCGCGGAAACCTGGAGTGGAAGGAGCCCCCCTCCATGCGCCTGAAGGCCCGACCCAGCAGCCCTGGCTTTTCCGTGCTTACCTGCAGCGCCTTCTCCTTCTACCCTCCGGAGCTGCAACTTCGGTTCCTGCGGAATGGGCTGGCCGCTGGCACCGGCCAGGGTGACTTCGGCCCCAACAGTGACGGATCCTTCCACGCCTCGTCGTCACTAACAGTCAAAAGTGGCGATGAGCACCACTACTGCTGCATTGTGCAGCACGCGGGGCTGGCGCAGCCCCTCAGGGTGGAGCTGGAATCTCCAGCCAAGTCCTCCGTGCTCGTGGTGGGAATCGTCATCGGTGTCTTGCTACTCACGGCAGCGGCTGTAGGAGGAGCTCTGTTGTGGAGAAGGATGAGGAGTGGGCTGCCAGCCCCTTGGATCTCCCTTCGTGGAGACGACACCGGGGTCCTCCTGCCCACCCCAGGGGAGGCCCAGGATGCTGATTTGAAGGATGTAAATGTGATTCCAGCCACCGCCTGA
ORF Protein Sequence MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-INN-814 Pre-Made Efgartigimod Alfa Biosimilar, Recombinant Protein targeting FCGRT: Recombinant therapeutic protein targeting FCRN/FcgammaRn/alpha-chain
    Biosimilar GMP-Bios-ab-498 Pre-Made Rozanolixizumab biosimilar, Whole mAb, Anti-FCGRT Antibody: Anti-FCRN/FcgammaRn/alpha-chain therapeutic antibody
    Biosimilar GMP-Bios-ab-411 Pre-Made Orilanolimab biosimilar, Whole mAb, Anti-FCGRT Antibody: Anti-FCRN/FcgammaRn/alpha-chain therapeutic antibody
    Biosimilar GMP-Bios-ab-378 Pre-Made Nipocalimab biosimilar, Whole mAb, Anti-FCGRT Antibody: Anti-FCRN/FcgammaRn/alpha-chain therapeutic antibody
    Biosimilar GMP-Bios-ab-050 Pre-Made Batoclimab biosimilar, Whole mAb, Anti-FCGRT Antibody: Anti-FCRN/FcgammaRn/alpha-chain therapeutic antibody
    Target Antibody GM-Tg-g-IP0110-Ab Anti-FCGRT monoclonal antibody
    Target Antigen GM-Tg-g-IP0110-Ag FCGRT protein
    ORF Viral Vector pGMLP002368 Human FCGRT Lentivirus plasmid
    ORF Viral Vector vGMLP002368 Human FCGRT Lentivirus particle


    Target information

    Target ID GM-IP0110
    Target Name FcRn/FCGRT
    Gene Group Identifier
    （Target Gene ID in Homo species)         		2217
    Gene ID 100147583 (Equus caballus), 101081512 (Felis catus), 114674122 (Macaca mulatta), 14132 (Mus musculus)
    2217 (Homo sapiens), 29558 (Rattus norvegicus), 338062 (Bos taurus), 476414 (Canis lupus familiaris)
    Gene Symbols & Synonyms FCGRT,Fcgrt,FcRn,FCRN,FcgammaRn,alpha-chain
    Target Alternative Names FCGRT,FCRN,FcRn,FcgammaRn,Fcgrt,IgG Fc fragment receptor transporter alpha chain,IgG receptor FcRn large subunit p51,Neonatal Fc receptor,alpha-chain
    Uniprot Accession P13599,P55899,Q61559
    Additional SwissProt Accessions: Q61559,P55899,P13599
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target, INN Index
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000002855, ENSMMUG00000012273, ENSMUSG00000003420, ENSG00000104870, ENSBTAG00000013926, ENSCAFG00845023878
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.