Human GYPB/CD235b/GPB ORF/cDNA clone-Lentivirus particle (NM_002100)

Cat. No.: vGMLP002304

Pre-made Human GYPB/CD235b/GPB Lentiviral expression plasmid for GYPB lentivirus packaging, GYPB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to GYPB/CD235b/GYPB/CD235b products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002304 Human GYPB Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002304
Gene Name GYPB
Accession Number NM_002100
Gene ID 2994
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 276 bp
Gene Alias CD235b,GPB,GYP,MNS,PAS-3,SS
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTATGGAAAAATAATCTTTGTATTACTATTGTCAGAAATTGTGAGCATATCAGCATTAAGTACCACTGAGGTGGCAATGCACACTTCAACCTCTTCTTCAGTCACAAAGAGTTACATCTCATCACAGACAAATGGAGAAACGGGACAACTTGTCCATCGTTTCACTGTACCAGCTCCTGTAGTGATAATACTCATTATTTTGTGTGTGATGGCTGGTATTATTGGAACGATCCTCTTAATTTCTTACAGTATTCGCCGACTGATAAAGGCATGA
ORF Protein Sequence MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAPVVIILIILCVMAGIIGTILLISYSIRRLIKA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0566-Ab Anti-GLPB/ GYPB/ CD235b monoclonal antibody
    Target Antigen GM-Tg-g-MP0566-Ag GYPB VLP (virus-like particle)
    ORF Viral Vector pGMLP002304 Human GYPB Lentivirus plasmid
    ORF Viral Vector vGMLP002304 Human GYPB Lentivirus particle


    Target information

    Target ID GM-MP0566
    Target Name GYPB/CD235b
    Gene Group Identifier
    (Target Gene ID in Homo species)
    2994
    Gene ID 2994 (Homo sapiens)
    Gene Symbols & Synonyms GYPB,SS,GPB,GYP,MNS,GYPA,PAS-3,CD235b
    Target Alternative Names CD235b,GPB,GYP,GYPA,GYPB,Glycophorin-B,MNS,PAS-3,SS,SS-active sialoglycoprotein,Sialoglycoprotein delta
    Uniprot Accession P06028
    Additional SwissProt Accessions: P06028
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG Malaria
    Gene Ensembl ENSG00000250361
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.