Human ARF1 ORF/cDNA clone-Lentivirus particle (NM_001658)

Cat. No.: vGMLP002285

Pre-made Human ARF1/ Lentiviral expression plasmid for ARF1 lentivirus packaging, ARF1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to ARF1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002285 Human ARF1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002285
Gene Name ARF1
Accession Number NM_001658
Gene ID 375
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 546 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGAACATCTTCGCCAACCTCTTCAAGGGCCTTTTTGGCAAAAAAGAAATGCGCATCCTCATGGTGGGCCTGGATGCTGCAGGGAAGACCACGATCCTCTACAAGCTTAAGCTGGGTGAGATCGTGACCACCATTCCCACCATAGGCTTCAACGTGGAAACCGTGGAGTACAAGAACATCAGCTTCACTGTGTGGGACGTGGGTGGCCAGGACAAGATCCGGCCCCTGTGGCGCCACTACTTCCAGAACACACAAGGCCTGATCTTCGTGGTGGACAGCAATGACAGAGAGCGTGTGAACGAGGCCCGTGAGGAGCTCATGAGGATGCTGGCCGAGGACGAGCTCCGGGATGCTGTCCTCCTGGTGTTCGCCAACAAGCAGGACCTCCCCAACGCCATGAATGCGGCCGAGATCACAGACAAGCTGGGGCTGCACTCACTACGCCACAGGAACTGGTACATTCAGGCCACCTGCGCCACCAGCGGCGACGGGCTCTATGAAGGACTGGACTGGCTGTCCAATCAGCTCCGGAACCAGAAGTGA
ORF Protein Sequence MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T47351-Ab Anti-ARF1 monoclonal antibody
    Target Antigen GM-Tg-g-T47351-Ag ARF1 VLP (virus-like particle)
    ORF Viral Vector pGMLP002285 Human ARF1 Lentivirus plasmid
    ORF Viral Vector vGMLP002285 Human ARF1 Lentivirus particle


    Target information

    Target ID GM-T47351
    Target Name ARF1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    375
    Gene ID 100060911 (Equus caballus), 100856517 (Canis lupus familiaris), 101100027 (Felis catus), 11840 (Mus musculus)
    338058 (Bos taurus), 375 (Homo sapiens), 64310 (Rattus norvegicus), 696052 (Macaca mulatta)
    Gene Symbols & Synonyms ARF1,Arf1,PVNH8
    Target Alternative Names ADP-ribosylation factor 1,ARF1,Arf1,PVNH8
    Uniprot Accession P84077,P84078,P84079,P84080
    Additional SwissProt Accessions: P84078,P84080,P84077,P84079
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG Phospholipase D signaling pathway, Pathogenic Escherichia coli infection, Legionellosis
    Gene Ensembl ENSECAG00000032327, ENSCAFG00845007924, ENSMUSG00000048076, ENSBTAG00000007725, ENSG00000143761, ENSMMUG00000052432
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.