Human PVALB/D22S749 ORF/cDNA clone-Lentivirus particle (NM_002854.2)

Cat. No.: vGMLP002247

Pre-made Human PVALB/D22S749 Lentiviral expression plasmid for PVALB lentivirus packaging, PVALB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to Parvalbumin/PVALB/PVALB/D22S749 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002247 Human PVALB Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002247
Gene Name PVALB
Accession Number NM_002854.2
Gene ID 5816
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 333 bp
Gene Alias D22S749
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCGATGACAGACTTGCTGAACGCTGAGGACATCAAGAAGGCGGTGGGAGCCTTTAGCGCTACCGACTCCTTCGACCACAAAAAGTTCTTCCAAATGGTCGGCCTGAAGAAAAAGAGTGCGGATGATGTGAAGAAGGTGTTTCACATGCTGGACAAGGACAAAAGTGGCTTCATCGAGGAGGATGAGCTGGGATTCATCCTAAAAGGCTTCTCCCCAGATGCCAGAGACCTGTCTGCTAAAGAAACCAAGATGCTGATGGCTGCTGGAGACAAAGATGGGGACGGCAAAATTGGGGTTGACGAATTCTCCACTCTGGTGGCTGAAAGCTAA
ORF Protein Sequence MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2683-Ab Anti-PVALB monoclonal antibody
    Target Antigen GM-Tg-g-IP2683-Ag PVALB protein
    ORF Viral Vector pGMLP002247 Human PVALB Lentivirus plasmid
    ORF Viral Vector vGMLP002247 Human PVALB Lentivirus particle


    Target information

    Target ID GM-IP2683
    Target Name Parvalbumin/PVALB
    Gene Group Identifier
    （Target Gene ID in Homo species)         		5816
    Gene ID 100069554 (Equus caballus), 101095270 (Felis catus), 19293 (Mus musculus), 25269 (Rattus norvegicus)
    481278 (Canis lupus familiaris), 538603 (Bos taurus), 5816 (Homo sapiens), 697272 (Macaca mulatta)
    Gene Symbols & Synonyms PVALB,Pvalb,pvalb1,PV,Pva,Parv,PALB1,D22S749
    Target Alternative Names D22S749,PALB1,PV,PVALB,Parv,Parvalbumin,Parvalbumin alpha,Pva,Pvalb,pvalb1
    Uniprot Accession P02625,P20472,P32848,P80079,Q0VCG3
    Additional SwissProt Accessions: P80079,P32848,P02625,Q0VCG3,P20472
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease Schizophrenia
    Disease from KEGG
    Gene Ensembl ENSMUSG00000005716, ENSCAFG00845008220, ENSBTAG00000019159, ENSG00000100362, ENSMMUG00000008778
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.