Human PRSS3/MTG/PRSS4 ORF/cDNA clone-Lentivirus particle (NM_002771)

Cat. No.: vGMLP002246

Pre-made Human PRSS3/MTG/PRSS4 Lentiviral expression plasmid for PRSS3 lentivirus packaging, PRSS3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to PRSS3/MTG products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002246 Human PRSS3 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002246
Gene Name PRSS3
Accession Number NM_002771
Gene ID 5646
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 744 bp
Gene Alias MTG,PRSS4,T9,TRY3,TRY4
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAATCCATTCCTGATCCTTGCCTTTGTGGGAGCTGCTGTTGCTGTCCCCTTTGACGATGATGACAAGATTGTTGGGGGCTACACCTGTGAGGAGAATTCTCTCCCCTACCAGGTGTCCCTGAATTCTGGCTCCCACTTCTGCGGTGGCTCCCTCATCAGCGAACAGTGGGTGGTATCAGCAGCTCACTGCTACAAGACCCGCATCCAGGTGAGACTGGGAGAGCACAACATCAAAGTCCTGGAGGGGAATGAGCAGTTCATCAATGCGGCCAAGATCATCCGCCACCCTAAATACAACAGGGACACTCTGGACAATGACATCATGCTGATCAAACTCTCCTCACCTGCCGTCATCAATGCCCGCGTGTCCACCATCTCTCTGCCCACCACCCCTCCAGCTGCTGGCACTGAGTGCCTCATCTCCGGCTGGGGCAACACTCTGAGCTTTGGTGCTGACTACCCAGACGAGCTGAAGTGCCTGGATGCTCCGGTGCTGACCCAGGCTGAGTGTAAAGCCTCCTACCCTGGAAAGATTACCAACAGCATGTTCTGTGTGGGCTTCCTTGAGGGAGGCAAGGATTCCTGCCAGCGTGACTCTGGTGGCCCTGTGGTCTGCAACGGACAGCTCCAAGGAGTTGTCTCCTGGGGCCATGGCTGTGCCTGGAAGAACAGGCCTGGAGTCTACACCAAGGTCTACAACTATGTGGACTGGATTAAGGACACCATCGCTGCCAACAGCTAA
ORF Protein Sequence MNPFLILAFVGAAVAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1213-Ab Anti-TRY3/ PRSS3/ MTG functional antibody
    Target Antigen GM-Tg-g-SE1213-Ag PRSS3 protein
    ORF Viral Vector pGMLP002246 Human PRSS3 Lentivirus plasmid
    ORF Viral Vector vGMLP002246 Human PRSS3 Lentivirus particle


    Target information

    Target ID GM-SE1213
    Target Name PRSS3
    Gene Group Identifier
    （Target Gene ID in Homo species)         		5646
    Gene ID 5646 (Homo sapiens)
    Gene Symbols & Synonyms PRSS3,T9,MTG,TRY3,TRY4,PRSS4
    Target Alternative Names Brain trypsinogen,MTG,Mesotrypsin,Mesotrypsinogen,PRSS3,PRSS4,Serine protease 3,Serine protease 4,T9,TRY3,TRY4,Trypsin III,Trypsin IV,Trypsin-3
    Uniprot Accession P35030
    Additional SwissProt Accessions: P35030
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG Neuroactive ligand-receptor interaction, Pancreatic secretion, Protein digestion and absorption, Influenza A
    Gene Ensembl ENSG00000010438
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.